KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120403Help
Entry
pRL120403         CDS       T00402                                 

Definition
(GenBank) putative dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
KEGG Orthology (KO) [BR:rle00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    pRL120403
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     pRL120403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 Shikimate_DH Methyltransf_12 Sacchrp_dh_NADP NNMT_PNMT_TEMT
Motif
Other DBs
NCBI-ProteinID: CAK12112
GeneDB: pRL120403
RhizoBase: pRL120403
UniProt: Q1M460
Position
pRL12:435712..436746
Genome map
AA seq 344 aa AA seqDB search
MRTRVARLYQKGDLRIETAAVAAPGPGEVLLKMAAAGICGSDLHYYQDGGFGPVRVREPI
IPGHEASGTVSQAGEGVDLKAGTLVAVNPSQPCGHCEYCQKNMPIHCLDMRFMGSAMRLP
HEQGMFREWLVVPAKQCFAVGAATTAAEAACSEPLSVCLHAASRAGDITGKRVLVTGAGP
IGALMVAVASYHHASEIVVTDLADAALDRAKAMGASRTINVSKNAQALAEFEAGKGYFDL
VFECSAAAPAIRGAIAAIRPRGTIVQVGVTGDVPIPLNAIVGKELQLHGTQRFHEEFGTA
VELISSRKIDVRPIISHSLPLEEATAAFTLAGDRAAACKVQLTF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcggacacgtgtggcacggctttaccaaaagggcgacctcaggatcgagaccgccgcg
gttgcggcccctggtcccggggaggtgcttctcaaaatggcggccgcagggatttgcggc
tccgacctgcattattatcaggacggcggcttcgggcctgtccgggttcgcgagccgatc
atacccggccacgaggcctcggggaccgtgagccaagcgggcgagggcgtcgatctgaag
gctggcacgctggtggcggtcaatcccagccaaccctgcgggcattgcgaatattgccag
aaaaacatgccgatccactgcctggacatgcgcttcatgggcagtgcgatgcgcctgccg
catgagcagggcatgttccgggaatggctggtggtgccggccaagcaatgctttgcggtc
ggagctgcgacaaccgccgcggaagcggcctgcagcgagccgctctccgtctgcctgcac
gcggcatcgcgcgcaggagatatcacaggcaaacgcgtgctggtcaccggagccggcccg
atcggcgccctgatggttgccgtcgcctcctatcaccatgcaagcgagatcgtggtgaca
gatctcgcggacgcggcgctggaccgggccaaagcgatgggcgccagccgcacgatcaat
gtttccaaaaacgcccaggcgcttgccgaattcgaggcgggaaagggctatttcgatctc
gtcttcgaatgctcggccgccgccccggccatccgcggcgcaattgccgccatcaggccg
cgcggaacgatcgtgcaggtcggcgtcacaggagacgtcccgatcccgctcaacgccatc
gtcggcaaggagcttcaactccacggaacgcagcgcttccacgaggagttcggtactgcc
gtcgagctgatctccagccgcaagatcgatgtgcggccgatcatcagtcacagcctgccg
ctcgaagaagccaccgcagccttcaccctcgccggcgaccgcgcggccgcctgcaaggtg
caactgactttttag

DBGET integrated database retrieval system