KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120405Help
Entry
pRL120405         CDS       T00402                                 

Gene name
braD2
Definition
(GenBank) putative permease component of ABC transporter
  KO
K01997  branched-chain amino acid transport system permease protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02010  ABC transporters
rle02024  Quorum sensing
Module
rle_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:rle00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    pRL120405 (braD2)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    pRL120405 (braD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rle02000]
    pRL120405 (braD2)
Transporters [BR:rle02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    pRL120405 (braD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 YniB
Motif
Other DBs
NCBI-ProteinID: CAK12114
GeneDB: pRL120405
RhizoBase: pRL120405
UniProt: Q1M458
Position
pRL12:438394..439266
Genome map
AA seq 290 aa AA seqDB search
MLSTILEQSVNGIVTGSVYAIVAVGMTMIFGVLRAINFAHGEYYMLGTFGAWFAIDYLGL
SYEVSIVVGVLATIAVAYVVGQLVMRRMVGAPAESGVLATLGIALILQNTIILVFGGGYK
FFAGGYIEPVSILGFSLAEQRILILVVCLLVFIGLELMVSYTRLGMAMRAVSQNVECCSV
VGIDVPQVVLRTFMLGAALAALSGVLTAPVNVSVYGGMGELITFKTLPIIIMGGLGNVRG
TFVAAMILGVAESLVATYVGLQFRDTVGFATLILMLMWRPHGLFSTQARF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgctctcgaccatactcgagcaatctgtgaatggaatcgtcacgggttccgtttacgcc
atcgtcgccgtcggcatgaccatgattttcggcgtgctgagagccatcaattttgctcac
ggcgaatactacatgctcggcacgttcggggcctggtttgcgatcgattatctcggcctg
tcctacgaagtgtcgattgtcgtgggcgttcttgcgacaatcgccgttgcctatgtggtc
gggcaactcgtcatgcgccggatggtcggcgcgcccgcggagtcgggcgtgctcgccacc
cttggcatcgcgctgatcctgcagaacaccatcattctcgtcttcggcggaggctacaag
ttcttcgccggaggctatatcgaaccggtttccatcctgggcttcagtctggccgagcag
cgcattctcattctcgtcgtctgcctgttggtattcatcggcctcgaactgatggtcagc
tacacccgcctcggaatggcgatgcgcgccgtttcccagaacgtcgagtgctgcagcgtc
gtcggcatcgatgtgccacaggtggtgcttcgaaccttcatgctgggggcggccctcgcc
gcactttcgggtgttctgacggcgccggtcaatgtcagtgtttatggcggcatgggcgag
ttgatcaccttcaagacgctgccgatcattatcatgggcggtttggggaatgtgcgtgga
actttcgtcgcggcgatgatccttggcgttgccgagagcctggtcgccacctatgtcggc
ttgcaattccgcgacacggtcggcttcgccacgctgatcctgatgctgatgtggcgaccg
catggcctcttttcgacgcaggcgcgcttctag

DBGET integrated database retrieval system