KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120407Help
Entry
pRL120407         CDS       T00402                                 

Gene name
braF2
Definition
(GenBank) putative nucleotide binding protein
  KO
K01995  branched-chain amino acid transport system ATP-binding protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02010  ABC transporters
rle02024  Quorum sensing
Module
rle_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:rle00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    pRL120407 (braF2)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    pRL120407 (braF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rle02000]
    pRL120407 (braF2)
Transporters [BR:rle02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    pRL120407 (braF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 BCA_ABC_TP_C AAA_23 AAA_15 SbcCD_C MTTB
Motif
Other DBs
NCBI-ProteinID: CAK12116
GeneDB: pRL120407
RhizoBase: pRL120407
UniProt: Q1M456
Position
pRL12:440292..441065
Genome map
AA seq 257 aa AA seqDB search
MTSHLPLLEIKNLSKSYGAVKAVNDVSIHIDRGEIAGLIGPNGSGKSTFFDCSTGLAKPD
TGTVVLDGQDITGWSLNRIAREGRMLRSFQKTVTFRSLDVEENLVIAGQMFTFPSITSTF
GLGKMSRQRVGGLRERARDLIKMAGLWDVRHQPAGNLSGGQQKLIQFASMLMPEPKLILL
DEPMAGINPKIIERVVDTIRYANKSLGVSFLVIEHNIDVVTSICQRVIVLDQGAKLVEGL
PGDIIQDQRVREAYLGG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtcatcttccgcttctcgagatcaagaacctcagcaagtcctacggtgcggtc
aaggccgtcaacgatgtcagcattcacatcgatcgaggtgagatcgcgggcctgatcgga
ccgaacggctccggcaagtcgaccttcttcgattgcagcaccggccttgcaaagccagac
accggcacggtcgtccttgatggacaggatatcaccggttggtccttgaaccgcatcgcc
agggaaggtcgcatgctgcggtctttccagaagaccgtcactttccggtcgctcgatgtc
gaggagaacctggtcatcgccggtcagatgttcaccttcccgtccatcacctcgaccttc
ggtctcggaaagatgtcccggcagcgcgtcggtggtctccgggagcgagctcgcgacctc
atcaagatggcgggtctttgggatgtgcgccatcagccggcgggcaatctgtcgggcgga
cagcagaaacttatccagttcgcatccatgttgatgcccgaaccgaagctcatcctgctg
gatgagccgatggccggcatcaatccgaagatcatcgaacgcgtcgtcgacaccatccgt
tatgcgaacaagtcgcttggcgtgagcttcctggtgatcgagcataatatcgatgtcgtc
accagcatctgccagcgcgtcatcgtgctcgaccagggagccaagctcgtcgaaggcttg
ccaggcgacatcattcaggatcagcgcgtcagggaggcctatcttggagggtaa

DBGET integrated database retrieval system