KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120409Help
Entry
pRL120409         CDS       T00402                                 

Gene name
aatA3
Definition
(GenBank) putative aspartate aminotransferase B
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00220  Arginine biosynthesis
rle00250  Alanine, aspartate and glutamate metabolism
rle00270  Cysteine and methionine metabolism
rle00330  Arginine and proline metabolism
rle00350  Tyrosine metabolism
rle00360  Phenylalanine metabolism
rle00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rle00401  Novobiocin biosynthesis
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01130  Biosynthesis of antibiotics
rle01210  2-Oxocarboxylic acid metabolism
rle01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    pRL120409 (aatA3)
   00270 Cysteine and methionine metabolism
    pRL120409 (aatA3)
   00220 Arginine biosynthesis
    pRL120409 (aatA3)
   00330 Arginine and proline metabolism
    pRL120409 (aatA3)
   00350 Tyrosine metabolism
    pRL120409 (aatA3)
   00360 Phenylalanine metabolism
    pRL120409 (aatA3)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    pRL120409 (aatA3)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    pRL120409 (aatA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rle01007]
    pRL120409 (aatA3)
Enzymes [BR:rle01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     pRL120409 (aatA3)
Amino acid related enzymes [BR:rle01007]
 Aminotransferase (transaminase)
  Class I
   pRL120409 (aatA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: CAK12118
GeneDB: pRL120409
RhizoBase: pRL120409
UniProt: Q1M454
Position
pRL12:441840..443048
Genome map
AA seq 402 aa AA seqDB search
MSTFVPASRVSRIKVSPSTAAAARARELKAAGRDIVDLTVGEPDFDTPDNIKAAAHAAID
RGETKYTAVNGTPALRKAIIGDIKRRLGLSYADNEICVGGGAKQILFLALMASVENNAEV
IIPAPYWVSYPDMVIANEGKPVIIECPQETGFKLTPEALERAITPKTLWLVLNAPSNPTG
AAYDRSELEALGKVLLRHPHVFVLSDDIYDQVWFKDEPMTTLVAAVPELKERVLLTNGVS
KSYAMTGWRIGYAAGPAVLIAAINKLQSQMSSCPSSVSQAAAAYALSSDQSFVTESVTVY
RKRRDYACSRLNAVPGLSCLVPDGAFYLFPNCAGVIGKKTPEGKTIETDLDFVLYLLDGV
GVAALQGAAYGVSPHFRLSIATSMEAITQACDRIERAVADLY
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttttgtgcctgcatcgcgtgtgtccagaatcaaggtttcgccaagcacggct
gcggcagcccgggctcgcgaactgaaggcagccggccgcgatatcgtcgacctgaccgtc
ggcgagccggacttcgatacgcctgacaacatcaaggccgcggcgcacgcggccatcgac
aggggcgaaaccaaatataccgccgtcaacggcacgccggcgctgcgcaaggcaatcatc
ggcgatatcaagcgccggctcggcctcagctacgcagacaacgaaatctgcgtgggtggc
ggcgccaagcagattctgtttctggcgcttatggcgagcgtggaaaacaatgccgaggtg
atcatccccgcaccatactgggtctcctatcccgatatggtcatcgccaacgaaggcaag
ccggtcattatcgaatgcccacaggaaacaggcttcaagctcacgccggaggctttggaa
agagcgatcacgccgaagaccttgtggctggttctcaacgcgccgtccaatccaacgggc
gcggcatatgacaggagcgagctcgaagccctcggcaaagtgctgctgcgccatccccac
gtcttcgtgctttccgacgacatttacgaccaggtctggttcaaggacgagccgatgacg
acgctggtggccgccgtcccggaactgaaggagcgtgttctgctcaccaacggcgtctca
aagtcctacgccatgaccggatggcgtatcggctacgcggcgggtccggccgtcttgatc
gcagccatcaacaagctgcagtcgcagatgtcgtcctgcccgtcgtcggtcagtcaggcc
gcagccgcctatgcgctgtcttcggaccagtcattcgtcacggaaagcgtgacggtctac
agaaagcgccgggattatgcgtgctcacggctcaacgcggtgccaggcctctcctgcctg
gtgcctgacggcgctttctatctgtttccgaactgcgctggtgttatcggcaagaagacc
cccgaaggtaagacaatcgagacagacctcgatttcgtgctctatctgctcgatggcgtc
ggggtcgcggcgctgcagggtgccgcctacggagtatcgcctcatttccgtctctcgatc
gcaacgtcgatggaggcaatcacgcaggcatgcgatcgcattgaacgggctgttgccgac
ctgtattga

DBGET integrated database retrieval system