KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120410Help
Entry
pRL120410         CDS       T00402                                 

Definition
(GenBank) putative LysR family transcriptional regulatory protein
  KO
K19338  LysR family transcriptional regulator, nitrogen assimilation regulatory protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
KEGG Orthology (KO) [BR:rle00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rle03000]
    pRL120410
Transcription factors [BR:rle03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    pRL120410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 NgoMIV_restric
Motif
Other DBs
NCBI-ProteinID: CAK12119
GeneDB: pRL120410
RhizoBase: pRL120410
UniProt: Q1M453
Position
pRL12:443128..444066
Genome map
AA seq 312 aa AA seqDB search
MSVDFRKLKSFVKIVDTGSVSRAASLLRTAQPALSQQIAALEAHFKHKLLIRSNVGITPT
EAGLILYRHAQLMLKQIEQAQVDIDQAAKSVAGRVSIGLATYSSSSALSLPILKEMKARH
PHIVVHINDSFGQILSELIMTGKMDMALIYAAAPIKGVTLQPLFREEMFLVSPPGIELPG
ESSAPLPLSALQDIPLLLPSKAHLLRRLIDDALARARATPDVVAEIESVPALSAAVLDGL
GSTILPASVVTETAIFSGAQVRALTKPVIDATVSLCVADHLPLSEPAIAARSVLLDVVGK
LMSSHHPGIRPA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgatttccgaaaactgaagagcttcgtcaagatcgtcgatacaggcagcgta
tcgcgagcagcaagccttctgaggacggcccagccggcactgtcgcagcagattgccgct
ctcgaagcgcacttcaagcacaagcttctcatccgcagcaatgtcggcattacgccgacc
gaggcggggctcatcctctatcggcatgcgcaactgatgctgaagcagatcgagcaggcg
caggtcgacatcgatcaggccgccaaatcggtggcgggccgcgtctcgatcgggcttgcg
acctattcctcgtcaagcgccttgtcgctgccgatcctcaaggagatgaaggccaggcat
ccccatatcgtcgtccacatcaatgacagtttcggccagatcctcagcgaactgatcatg
acgggcaagatggatatggcgctgatctatgccgctgccccgatcaagggcgtcaccctg
cagccattgtttcgcgaggaaatgttccttgtctcgccgccgggaatcgaacttcccggc
gagagcagtgcgccgcttcccctctctgccctccaggatattccgctgctgcttcccagc
aaggcacatctgctccggcggctgatcgacgacgccctggcgagagcgagagccacacct
gatgtcgtcgcggaaatcgaatccgttccggccctcagcgcggccgtcctcgatgggctt
ggatcgaccattctgccggcttcggtggtcaccgagactgcgatcttttcaggcgcgcag
gtgcgggcgctgacgaagccggtgattgacgcgaccgtgtcgctttgcgtcgccgatcat
cttcccttgtcggaacccgccatcgctgcgcggtcggttctcctcgatgtcgtgggcaag
ctcatgagcagtcatcaccccggaatcaggccggcttag

DBGET integrated database retrieval system