KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120411Help
Entry
pRL120411         CDS       T00402                                 

Gene name
hyuA2
Definition
(GenBank) putative hydantoin utilization protein A
  KO
K01473  N-methylhydantoinase A [EC:3.5.2.14]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00330  Arginine and proline metabolism
rle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    pRL120411 (hyuA2)
Enzymes [BR:rle01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.14  N-methylhydantoinase (ATP-hydrolysing)
     pRL120411 (hyuA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydantoinase_A Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: CAK12120
GeneDB: pRL120411
RhizoBase: pRL120411
UniProt: Q1M452
Position
pRL12:444260..446323
Genome map
AA seq 687 aa AA seqDB search
MAKLAFDTGGTFTDFALLDDKGDLHLHKVLSTPKNPAEAVVQGVSELLEKFAGTIAIENL
QVLGATTVVTNAVLERKGVETGFVTTDGFQDMLRIRNEGRYDLYDLNIKYPDPLVTRANS
FGAEERIAADGSVMTELKEETVREIAGRLKEKGIRSVAVCLLHAYKYPQHEQRVAALLRE
EHPDIFVSLSSEVCPEMREFDRASTTVVNAYTRPQMAGHVAHLQREFAAKGIDRQVLWMT
SSGGLVPSRRAAELPVRLIESGPAAGAVAAAEFGRTAGEASVLSFDMGGTTAKLCLIPDG
EPNVGTDLEVAHYQRFRKGSGFPLKIQSIQMIEIGAGGGSIAAKNPLGLLDVGPHSAGAM
PGPAAYQRGGTQPTVTDADILLGYMGTESFVGGSFKVSKEAAHEAMAKLAASLEVSVERC
AWGIHDLVNESMSKAAAMHATDLGVDPRSLPMVAFGGAGPVHAYGIARKLGISRIICPTG
AGVSSAIGLLIAPVAVDLSASHPMALDAWNMDAMNRLLDELSAQGAEVVSAAGVPKDTIS
NRYTVDMRHVGQGHEITVVLPDRNLPKEEFLSELRGNFFKLYHELFGRTVAAPLEVITWR
LRAGGKKDQVTRPHETVVADAKKGSRKVYFQEIGGFTETAVYDHYKLPVGEEVRGPAIVE
QRESTAVVGPSGAFHVDAHGNLVINIR
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactggctttcgacacgggcggtacctttaccgacttcgcgctcctggacgac
aagggcgaccttcaccttcacaaggtcctgagcacgccaaagaatcctgcagaagcagtc
gtgcagggtgtgtccgaattgctggaaaaattcgcgggcaccatcgccatcgagaacctg
caagtgctgggcgccaccaccgtcgtcaccaacgcggttctcgagcgcaagggcgtcgag
acggggttcgtcaccaccgacggttttcaggacatgctgcgtatccgcaacgaagggcgc
tacgacctctacgacctgaatatcaaatatcccgacccgctggtcacccgcgcaaacagc
ttcggcgccgaagagcgtatcgcggctgacggttctgtcatgaccgagctcaaggaagag
acggtgcgagaaatcgccggccgcctgaaggagaagggcatccgctccgtcgccgtctgc
cttctccatgcctacaagtatccccagcacgagcagcgcgtcgcagcgctgctgcgcgaa
gaacaccctgacatcttcgtctcgctttcttccgaagtctgccctgagatgcgcgagttc
gatcgcgcgtcgacgactgttgtcaatgcctataccaggccgcagatggctgggcacgtc
gctcatctccagcgtgagttcgctgcgaagggcatcgatcggcaggtcctctggatgacg
tcatcgggcgggctggtgccgagccggcgtgccgcagaactgccggtacgcctgatcgag
tcaggccctgcggccggcgccgtggccgctgccgagttcggccgcacggcaggtgaggcg
agtgtcctgtccttcgacatgggcggcacgaccgcgaagctctgcctgatccccgacggt
gagccgaatgtcggcaccgacctcgaagtcgcccattatcagcgcttccgcaaaggatcc
ggtttcccgctgaagatccagtcgatccagatgatcgagatcggcgcgggcggcggttcg
attgcggccaaaaaccctctcggtctgcttgacgtcggcccgcactctgcaggcgccatg
cccgggccggccgcctaccagcgcggcggcacccagccgaccgtcacggatgccgacatc
ctgctcggttacatgggcaccgaatccttcgtcggcggctcgttcaaagtttccaaggaa
gccgcccacgaggcgatggccaaacttgccgcatcgctcgaggtctcggtcgaacgctgc
gcatggggcatccatgacctcgtcaacgaatccatgagcaaggcggccgccatgcatgcg
accgatctcggcgtcgatccccgttcgctgcccatggtcgcgttcggcggcgccggtccg
gtccacgcctatggcatcgcccgcaagctcggcatttcccgcatcatctgcccgaccggt
gcaggcgtgagctcggcgatcggcctgttgatcgctcccgtggcggtcgatctgtccgca
agccatccgatggcactcgacgcttggaatatggacgccatgaaccgtctgctggacgaa
ctctcggcccaaggtgccgaagtcgtgtcggcggcgggcgtgccgaaggatacgatcagc
aaccgctacaccgtcgacatgcgccatgtcggccagggccacgagatcaccgtggttctg
cctgaccggaacctgccgaaggaggaattcctcagtgagctccgtggcaatttcttcaag
ctgtaccatgaactgtttggccgtaccgttgccgcgccgctggaggtcatcacctggcgc
ctgcgcgccggcggcaaaaaagatcaggtcacgcgcccgcacgagaccgtcgttgccgac
gcgaagaagggcagccgcaaggtctacttccaggagatcggcggctttaccgagactgcg
gtctacgaccattacaagcttcccgtcggcgaagaggtcaggggtccggcaatcgtcgag
cagcgtgaatcgactgcggtcgtcgggccaagcggcgccttccatgtggatgcccatggc
aacctcgtgatcaacattcgctaa

DBGET integrated database retrieval system