KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120419Help
Entry
pRL120419         CDS       T00402                                 

Gene name
opaA
Definition
(GenBank) putative omega-amino acid:pyruvate transaminase
  KO
K00822  beta-alanine--pyruvate transaminase [EC:2.6.1.18]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00280  Valine, leucine and isoleucine degradation
rle00410  beta-Alanine metabolism
rle00640  Propanoate metabolism
rle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    pRL120419 (opaA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    pRL120419 (opaA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    pRL120419 (opaA)
Enzymes [BR:rle01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.18  beta-alanine---pyruvate transaminase
     pRL120419 (opaA)
Amino acid related enzymes [BR:rle01007]
 Aminotransferase (transaminase)
  Class III
   pRL120419 (opaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CAK12128
GeneDB: pRL120419
RhizoBase: pRL120419
UniProt: Q1M444
Position
pRL12:complement(453819..455153)
Genome map
AA seq 444 aa AA seqDB search
MDQISKTNAPVLENFWMPFTANRQFKATPRLLAAAEGMYYTDVDGHQVLDGTAGLWCCNA
GHGRKKIAHAVERQLATLDYAPTFQMGHPIAFDFASKLAANAPGGPEAKLDRIFFTGSGS
ESVDTALKIAIAYQRAIGQGTRTRIIGREKGYHGVGFGGISVGGLVNNRRVFPQIPADHM
RHTLDIERNAFSKGLPAHGVELADDLERLVQLHGAETIAAVIVEPMSGSAGVVLPAKGYL
EKLRATADKHGILLIFDEVITGFGRLGTPFAADYFGVVPDLITTAKGITNGSIPMGAVFA
SRKVYDGLMVGPDNAIELFHGYTYSGHPVACAAGLATLEIYEEEGLLTRAADLAEYWQEA
LHSLKGLPHVVDIRNLGLVGAVELASRDGAPGTRAYDIFVDCFNKGLLIRVTGDIIALSP
PLIIEKSQIDTIVSILGDALKRAA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggaccagatcagcaaaacgaacgcgcccgtactcgaaaatttctggatgccattcacc
gcgaaccggcaattcaaggccacgccgcggcttctcgcagccgcggagggaatgtactac
accgacgtcgatggacatcaggtgcttgacggcaccgccgggctctggtgctgcaatgcc
ggccacggccgcaagaagatcgcccatgccgtcgagcgacagcttgcaacgctggactat
gcgccgacctttcagatggggcatccgatcgccttcgacttcgcctcaaaactggctgcg
aacgcgccgggcggcccggaagccaagctcgacaggatattcttcaccggctcaggctcg
gaatcggtcgatacggcgctgaagatcgccatcgcctatcagcgggcgatcggccagggc
acccgcacgcggatcatcgggcgcgagaagggatatcatggcgtcgggttcggcggcatt
tccgtcggcggtctcgtcaacaaccggcgggtcttcccgcaaataccggccgaccatatg
cgccacacgctcgacatcgagcgcaatgcgttctcaaagggtcttcccgctcacggcgtg
gaactggcggacgatctcgagcgcctggtgcaactgcacggcgccgaaaccatcgcagcg
gtcatcgtcgagccgatgtcgggatcggcaggcgtggttctgcctgcgaagggctatctg
gagaaactgcgcgcaaccgccgacaagcacggaatcctgctgatcttcgacgaggtcatc
accggcttcggacgtctcggcactcctttcgcggccgactacttcggcgtcgtgcccgac
ctgatcaccacggcaaaaggcatcaccaacggctcgatccccatgggcgcggtctttgcc
agcaggaaggtctatgacggcctgatggtcggacccgataacgcgatcgaactcttccat
ggctacacctattccggccatccggtcgcctgtgcggccgggctcgctactctggagatc
tacgaggaggaaggcctgctgacccgcgcagccgatttggccgagtactggcaggaggcc
ctccattcactgaaaggcctgcctcatgtcgtcgacatccgcaatctcggactggtcggc
gcagtcgaactggcttctcgtgacggggcgcctggaacccgcgcctatgacatcttcgtt
gactgcttcaacaagggcctgttgatccgggtaaccggcgacattatcgccctctccccg
ccgctcattatcgagaaaagccagatcgacacgatcgtttcgatcctcggtgatgccctg
aagcgcgcggcatag

DBGET integrated database retrieval system