KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120432Help
Entry
pRL120432         CDS       T00402                                 

Definition
(GenBank) putative permease component of ABC transporter
  KO
K02034  peptide/nickel transport system permease protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02024  Quorum sensing
Module
rle_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:rle00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    pRL120432
Transporters [BR:rle02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    pRL120432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N
Motif
Other DBs
NCBI-ProteinID: CAK12141
GeneDB: pRL120432
RhizoBase: pRL120432
UniProt: Q1M431
Position
pRL12:complement(465098..465988)
Genome map
AA seq 296 aa AA seqDB search
MAVITADLASEAPKILKSPGFWSGVVRRLCRDPVALAALGVVILLVLIAIFAPYIAPYDP
SKGSVIRRLKPIGTPGYMLGTDELGRDMLSRLIYGARLSLVMGVIPVPIAFVIGSGIGII
AGYAGGITNTLIMRTIDVFYAFPSVLLAVALSGALGSGLTNALVSLTVVFIPQIARVAES
VTTQVRKLDYVDAARASGAPDRTIIRVHILGNVLSPIFVFATSLISVSMILASGLSFLGL
GVRPPDAEWGLMLNTLRTAIYNNPFVAALPGLMIFTTSVCFNLFSDGLRTAMDVKS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcattacagcagatctggcctcggaagcgcccaaaatcctcaaatcaccgggt
ttctggagcggtgtcgttcgccgtctttgtcgtgatccggtggcgctcgcggctttgggc
gtcgtcattcttttggtgctcatcgcgatattcgcgccctatatcgccccttacgacccg
tcgaaaggcagcgtcattcgccgcctaaagccgatcgggacgcccggatatatgctcggc
accgacgaacttggacgcgatatgctctcgcgtttgatttatggcgcccgtctctctctg
gtgatgggcgtcatcccggttccgatcgccttcgtcatcggctcaggaatcggcatcatt
gccggttatgccggcgggatcaccaacacgctgatcatgcgcacgatcgacgtcttttac
gcattcccctccgtgctgctcgccgtcgctttgtcaggcgcccttggttcgggcctgacc
aatgcgctggtctcgctgaccgtggtcttcatcccgcagatcgcgcgcgttgcagaaagc
gtcacgacccaggtcaggaaactcgactacgtcgatgcggcccgcgcatccggcgctcct
gatcgcaccatcattcgggtgcacattctcggcaatgttctcagtcccattttcgtcttc
gccaccagcctgatctcggtctcgatgatacttgcgtccggcttgtcgtttctcggcctt
ggcgtgcgtccgcccgatgccgaatggggactgatgttgaatacgctgagaacagcgatc
tacaacaatccgttcgtcgcggctctgccgggattgatgatcttcaccacctcggtctgc
ttcaatcttttctccgacgggctgcgcacagccatggacgtgaaatcatga

DBGET integrated database retrieval system