KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120440Help
Entry
pRL120440         CDS       T00402                                 

Definition
(GenBank) putative nitrilase/cyanide hydratase family protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: CAK12149
GeneDB: pRL120440
RhizoBase: pRL120440
UniProt: Q1M424
Position
pRL12:complement(473656..475407)
Genome map
AA seq 583 aa AA seqDB search
MGTTMTSTQSYTAATIQFEPTMFEKARNISRLTALCEEAAEAGARLIVTPEMGTTGYCWF
DRAEVKPFVETIPGATTDVFQAIASKHRCYIVVGMPEVDPASDLYYNTAVLIGPGGVVGR
HRKSHPYIAEPKWAANGDIVHEVFETEIGRISMLVCMDLHFFETARLEALAGADIICHIS
NWLQERTPAPYWINRAFENACYVIESNRWGLERTVQFSGGSCLIEPDGTVAASIDTGDGI
AYGTVDLARARRREVLFEPVFKSRRPELYMNMMTNSFTWNPGDYFRLYGYQPIPRGRASR
AAVAQFAPTSVVADNLARIADLAAEAKATTAPDILVFPELSLTGLEAPHGRAESLSGPTV
SAFVRLAMKLGFYLVAGFAEEDGDKVYNSAVLAGPEGLVGSYRKTHLGIADSWATAGDEW
KVYDLAIGRVGLAVGHDALYPEAIRSLALMGCDVVACPSAIAGTFTGSHTGTKIPHNYPI
PKGADPYHWHALRVRGGENNLYFAFANVLDAARGYQGKSAVFGPDSFAFPRQESAILDED
GIAAAAVDTTNLDTPYPTNIVRRKDLVVMRQPHHYQPLVKWHQ
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgggaacaaccatgacatcgacacaaagctataccgcggccaccatccagttcgaaccg
accatgttcgaaaaggcgcgcaatatcagccggctgacagccctttgcgaggaggcagcg
gaggcaggtgcgcgcctgatcgtcacgcccgaaatgggcacgaccggctattgctggttc
gacagggccgaggtgaaacctttcgtcgagactatccccggagcgaccacggatgttttc
caggccattgccagcaaacaccgctgctatatcgtcgtcggcatgccggaagtcgatccg
gcaagcgatctttactacaataccgccgtcctgatcggcccaggcggcgtcgttggccgg
catcgcaaatcgcatccctatatcgcggaaccgaaatgggctgccaacggcgacatcgtc
cacgaggtattcgaaaccgagatcggccggatctcgatgctggtctgcatggatctgcac
ttcttcgagacggcgcgcctggaggcactcgccggtgccgacatcatctgccatatctcc
aactggctgcaggagcgcacgccggcaccctattggatcaaccgcgccttcgaaaacgcc
tgctatgtgatcgaaagcaaccggtgggggctggagagaaccgtgcagttttccggtgga
agctgcctgatcgaaccggacggcacggtcgcagcatcgatcgatacgggcgacgggatt
gcctatggcacggtcgatcttgcccgcgcccgccgccgcgaggtcttgttcgaaccggtc
ttcaagtcccgccggcccgagctctacatgaacatgatgaccaacagcttcacctggaat
ccgggcgattacttccgtctctatggctaccagccgatcccgcgcggacgcgcatcgcgc
gccgccgtcgcccagttcgcccccacctccgttgtcgccgacaatctcgcccgcatcgcc
gatctggcagccgaggcgaaggcaacgacagcaccggatattctggtgttcccggaacta
tctctgacaggattggaggccccgcatggcagggcggaatcgctctcgggcccgacggta
tcggccttcgttcgtctggcgatgaagctcggtttctatcttgtagccggatttgccgaa
gaggacggggacaaggtctacaacagcgctgttctcgccggccccgagggcctcgtgggc
agctatcgcaagacacatctcggcattgccgacagctgggcgacggccggcgacgaatgg
aaagtctacgatcttgccatcggccgcgtcggcctggcggtcggccatgacgcgctctat
ccggaagccatccgttcgctcgcgctgatgggatgcgacgtggtcgcttgcccatcagcc
atagcaggcactttcaccggcagccacaccggcacgaaaatcccgcataactatccgatc
cccaagggcgccgatccctaccactggcatgcgttgcgcgtgcgcggtggcgagaacaac
ctctatttcgccttcgccaacgtcctggatgcggcacggggataccaaggcaagagcgct
gtcttcgggccggattcctttgcctttccgcgtcaggaatcggcaatcctggacgaggac
gggattgcggcggcagccgtcgacaccaccaatctcgacacgccttatccgacgaacatc
gtcagacgaaaggatcttgtcgtcatgcgccagccgcatcactatcagccgctcgtcaaa
tggcatcagtga

DBGET integrated database retrieval system