KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120446Help
Entry
pRL120446         CDS       T00402                                 

Definition
(GenBank) putative ANTAR RNA-binding transcriptional regulator
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ANTAR
Motif
Other DBs
NCBI-ProteinID: CAK12155
GeneDB: pRL120446
RhizoBase: pRL120446
UniProt: Q1M418
Position
pRL12:complement(480567..481175)
Genome map
AA seq 202 aa AA seqDB search
MSFALLRDLRDLKVLVIHPRTSEGEFLVDHLRRIGCTVSCLWPVPAELPHGTDVVFLAME
DEARPEIERLLKSFPNPAPTMLAIVGYENPSTLQIVLESGALAIVERPIKPFGLLTNLAI
ARNLWLERQKLVKEARKYKRKVLGDQKLARAKAILMANRGTSENEAYREMRDQAMARRVP
IDEIANSIINAEQLLRPPQKHD
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcgcccttctcagagatttgcgggatctcaaggttctggtcatccacccccgg
acatccgaaggagagtttctcgtcgatcacctgcgccgtatcggctgtacggtcagttgc
ctttggccggtgcctgccgagttgccgcacgggacagatgtcgtcttcctcgcgatggaa
gatgaggcgcgaccggaaatcgaacgcctgctgaagtctttccccaatcctgccccgacc
atgcttgccatcgtcggttacgaaaacccctcgacgctgcagatcgttctggaaagcggc
gcactcgccattgtcgaaagaccgatcaaaccctttggcctgctgaccaatctcgccatc
gcccgcaacctgtggctggagcggcaaaagctcgtcaaggaagcgcgcaaatacaaacgc
aaggtactgggcgaccagaaacttgctcgggccaaagccattctgatggccaatcgcggc
accagcgagaatgaggcgtatcgtgaaatgcgcgaccaggcgatggctcggcgggtgccg
atcgatgaaatcgccaattcgattatcaacgccgaacagctcttgcgcccgccccaaaaa
catgattag

DBGET integrated database retrieval system