KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120447Help
Entry
pRL120447         CDS       T00402                                 

Definition
(GenBank) putative transcriptional regulator
  KO
K01999  branched-chain amino acid transport system substrate-binding protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02010  ABC transporters
rle02024  Quorum sensing
Module
rle_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:rle00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    pRL120447
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    pRL120447
Transporters [BR:rle02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    pRL120447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_5 Peripla_BP_6 ANF_receptor Glyco_tran_WecB
Motif
Other DBs
NCBI-ProteinID: CAK12156
GeneDB: pRL120447
RhizoBase: pRL120447
UniProt: Q1M417
Position
pRL12:complement(481188..482339)
Genome map
AA seq 383 aa AA seqDB search
MMHSENWRVGVLFSETGVTGAVEKTQKAATVLAIDEINAAGGVLGRAIEPIAYDPQSTPN
LYKELAVKLCDEDRVRVVFGCHMSSTRKAVLPVIEARDALLFYPTLYEGFEYSRHCIYTG
AAPNQNSVQLVDFLTEHYGKRVFLVGSNYVYPYESNRTISDLFLQLGGQVLDEMYVPLNL
KNEDVAKIIQHIRAAQPDVIYSTIVGDGIIPFYTAFKEAGFDAATMPIASQSTSEADVIR
MRPDVAEGHITAAPFFASLDTPRARAFVSAYQQRYGLQMLPTAPAEAAYFQVYLYAAALQ
RAGGDGLEQLLPALYDVEYDAPQGAVKIDRTTNHTHLWPRVARVNPQGDYDIVYDPSLRV
APDPFMREYRPDLTRTFPHRVQV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgatgcattcagaaaactggcgggtcggtgtgctgttctccgaaacgggtgtgaccgga
gccgtggaaaaaacccaaaaggccgcgaccgtgctggcgatcgatgagatcaacgcggcg
ggcggcgtgctcggccgggcgatcgaacccatcgcctatgatccgcaatcgacgcctaat
ctctacaaggaacttgcagtcaagctttgcgacgaagaccgggtccgggtcgttttcggt
tgccatatgtcgagcacccgcaaagctgttctgcccgtcatcgaggcccgtgatgcactg
ctgttttacccgacgctctacgagggattcgaatactcccgtcactgcatctatacagga
gccgcccccaaccagaactccgtccagctcgttgacttcctgaccgagcattatggaaag
cgggtcttccttgtggggtcgaactacgtctatccttatgaatccaatcggacgatcagc
gacctgtttctccagctgggcggacaggtgctggacgagatgtatgttcccctgaacctc
aaaaacgaggacgttgcaaagatcatccagcatattcgcgcggcacagccggatgtcatc
tattcgacgatcgtcggcgacggtatcattcccttctacacggcgttcaaggaggccgga
ttcgatgcggcgacaatgccgatcgcgagccagtcgaccagcgaggcggacgtgatccgt
atgcggccggatgtggccgaggggcatatcaccgcagcccccttcttcgcctctctggat
acgccccgcgcccgcgccttcgtctcggcttaccaacagcgatacggcctgcagatgctg
ccgaccgcgccggccgaagcggcttatttccaggtttatctctatgcggcggctttgcag
cgcgccggtggcgacgggcttgagcagcttctgccggctctctatgatgtcgagtacgat
gccccgcagggcgcggtaaagatagaccggacgacaaaccacacgcatctgtggccaaga
gtggcaagggtgaatccacagggcgactacgacatcgtctatgatccgtcgctccgggtg
gcgccagacccgttcatgcgagaatatcgcccggacttgacgcggactttcccgcatcgt
gttcaggtttga

DBGET integrated database retrieval system