KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120448Help
Entry
pRL120448         CDS       T00402                                 

Definition
(GenBank) putative AraC family transcriptional regulator
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: CAK12157
GeneDB: pRL120448
RhizoBase: pRL120448
UniProt: Q1M416
Position
pRL12:complement(482804..483715)
Genome map
AA seq 303 aa AA seqDB search
MVQVLPLRQQSSTGNSTDGFGCSLKQLSINQSLPGSDIDIFRKATVNTELDQVMTPASDR
GFVVGVSSLGGHTRRIFHEHRATTHDFTENSIYIRDLSHAYKADLRGPFDFVLFEISPAS
LGKIADDAEMPGITSLSVETASKDIVLANLARALIPALEKPDEANALFVEQMTTAIGTYL
VQRYGGRPMVGSDRSGSLSRAQEDLAKSLLLENLDGNVSISDVAQVCNLSRGYFIRAFRQ
TTGMTPYQWVLRERISRARDILRTSNTPLAEVAIACGFADQSHFTRVFAGIVGTTPGNWR
RNA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtggtccaagtcctccccctccgccagcaatcttccaccggaaactcgaccgacgggttc
gggtgctcgttgaagcagttgtcgatcaaccaaagccttcctggttcagacatcgatatc
tttcgtaaggcgacagtcaacactgaactcgatcaggtcatgacaccggcaagcgatcga
gggttcgtcgtgggggtttcctcgctcggcggccacacgcgacgcatcttccacgaacat
cgtgcgacaacccacgactttaccgagaactcgatctatattcgcgatctctcgcacgcc
tacaaggcggatctccgcggtcctttcgatttcgtgttgtttgagatttcgccagcctcc
ctcggcaaaattgccgatgatgctgaaatgcccggcataacgtcgctgtcagttgaaaca
gcatcaaaagatattgtgcttgccaatctcgctcgggcgctgatcccggcgctcgaaaag
ccagacgaagccaacgcgcttttcgtcgaacaaatgacgaccgccatcggcacctacctg
gtccagcgctacggcggccggccaatggtaggctccgataggtcgggtagcctttcgcgg
gcgcaggaggatctggcgaaaagcctgcttctcgaaaaccttgatggcaacgtgtcgatt
tccgacgtcgcccaggtctgcaacctgtcacgtggctatttcattcgcgcttttcgtcaa
acgaccggtatgacgccctatcaatgggtccttcgtgagcgaataagccgtgcccgcgac
atcttgcggacctcaaatactcctctcgccgaagtggccatcgcctgcggcttcgcggac
caaagccatttcacgcgcgtctttgcgggtatcgtcggcaccacgcctggcaattggcgg
cgtaacgcgtag

DBGET integrated database retrieval system