KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120450Help
Entry
pRL120450         CDS       T00402                                 

Gene name
cpO
Definition
(GenBank) putative chloroperoxidase
  KO
K00433  non-heme chloroperoxidase [EC:1.11.1.10]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.10  chloride peroxidase
     pRL120450 (cpO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Peptidase_S9 Peptidase_S15 Esterase_phd DLH Abhydrolase_4 Abhydrolase_5 AXE1 DUF915 Abhydrolase_2 EHN tRNA_lig_kinase FSH1
Motif
Other DBs
NCBI-ProteinID: CAK12159
GeneDB: pRL120450
RhizoBase: pRL120450
UniProt: Q1M414
Position
pRL12:complement(484970..485806)
Genome map
AA seq 278 aa AA seqDB search
MGYITTKDGVEIFYKDWGPKDAQPIVFHHGWPLSSDDWDAQMLFFLAKGFRVVAHDRRGH
GRSAQVSDGHDMDHYAADAFAVVEALDLKNAVHIGHSTGGGEVARYVAKYGQPSGRVAKA
VLVSAVPPLMLKTETNPGGLPMEVFDGIRKGVADNRAQLFVDFPTGPFYGFNRPDAKVYP
GVIQNWWRQGMMGSAKAHYDGIKAFSETDQTEDLKAITVPTLVMHGDDDQVVPIDNAGKL
SVKLVQNGTLKVYQGYPHGMLTTHAEVLNADLLAFIQA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgggctacatcaccaccaaggacggcgtcgaaatcttctacaaggattggggtccgaag
gatgcccagccgatcgtctttcaccacggctggccgctctcgtcggacgattgggatgcg
cagatgctgttcttcctggcaaagggcttccgcgtcgtcgcccatgaccgccgtggccac
ggccgctctgctcaagtttctgacggtcacgacatggaccactatgccgccgatgccttc
gccgtggtcgaagcgctcgatctaaagaacgccgttcatatcggccattcaaccggcggc
ggggaagtcgctcgctatgtggcaaaatatggccagccttccgggcgcgtcgccaaggcc
gttctggtttccgccgttccgccgctgatgctgaagacggagacaaatccgggcggcctt
ccgatggaagtcttcgacggcattcgcaagggggtggccgataaccgcgcacagctgttc
gtcgatttccccaccggtccgttctacggcttcaaccgtcccgacgcgaaggtctatcca
ggcgtcatccagaattggtggcggcagggcatgatgggtagcgccaaggctcattacgat
gggatcaaggccttttccgagaccgatcagacggaagacctgaaggcaatcactgttccg
acgctcgttatgcacggcgacgacgatcaggtcgtgcccatcgacaacgctggcaagctg
tccgtcaaactggtgcagaatggcaccctcaaggtctatcagggttatccgcacggcatg
ctgacaacgcatgctgaggtcctgaacgccgacctcttggcatttatccaggcttaa

DBGET integrated database retrieval system