KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120458Help
Entry
pRL120458         CDS       T00402                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupredoxin_1
Motif
Other DBs
NCBI-ProteinID: CAK12167
GeneDB: pRL120458
RhizoBase: pRL120458
UniProt: Q1M406
Position
pRL12:complement(493557..493889)
Genome map
AA seq 110 aa AA seqDB search
MAMGSLMTSLQLPLLLALLWAGNGLASAADHQITITGMKFRSPPAELHFGDVIVWRNDDI
FTHTATARDTSFDIDLPAKSEGRMTLSQAGAVDFYCRFHPAVTGKLDVRP
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgggctcgctgatgacatcgctgcagctcccgctactcttagcactgctttgg
gcaggcaacgggcttgcctcggcggcggaccatcagatcaccatcaccggcatgaaattc
cgctcgccgcctgccgagctgcatttcggagatgtgatcgtctggcgaaacgatgacata
ttcacgcacacggcgaccgctcgcgacacaagcttcgatatcgacctgccggcgaaatcg
gaaggccgcatgaccctcagccaagcgggagccgtcgatttctattgtcgttttcatccc
gccgtgacgggcaaactggatgtccggccatag

DBGET integrated database retrieval system