KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120459Help
Entry
pRL120459         CDS       T00402                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K08995  putative membrane protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
KEGG Orthology (KO) [BR:rle00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    pRL120459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4142 DUF305
Motif
Other DBs
NCBI-ProteinID: CAK12168
GeneDB: pRL120459
RhizoBase: pRL120459
UniProt: Q1M405
Position
pRL12:complement(493892..494557)
Genome map
AA seq 221 aa AA seqDB search
MTDVDDTRPPRVRNFWEPFRPSCIQCSLPKAHIVPAGRHPVTTKGRQIMLKRILGATLLA
ASLGTASLAADAKRTDPQIAHIAYTAGQIDVTAAEQALKKSKNADVIAFAKTMERDHKAV
NDQALALVKKLKVTPGDNPVSQSLSTQATKELTTLEALDGAAFAKAYVENEVAYHKSVND
ALANILIPSAQNKELKSLLETGMPLVQGTSEHAEHLASMIK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgtcgatgacacccggcctccccgtgtccgaaatttctgggaaccttttcgt
ccgagctgcatccaatgctcgcttccgaaggcacacatcgttcccgccggaaggcatcca
gtcacgacaaaaggaagacagatcatgttgaaacgaattctcggcgccactctgctggcg
gcatcgctcggcacggcttcgctcgccgccgatgccaagcggaccgatcctcagatcgcc
cacatcgcctatacggcgggacagatcgatgtcaccgcggcagagcaggcgctgaagaag
agcaagaatgccgacgtcattgcattcgccaaaaccatggagcgcgaccacaaggccgtc
aacgaccaggcgctcgccctcgtcaagaagctgaaggtgacgcccggagacaaccccgtc
agccagtccctttcgacacaggcgaccaaggaactgacgacgctggaagcgctcgacggc
gcggcattcgccaaggcctatgtcgaaaacgaggtcgcctatcacaagtcggtcaacgac
gcgcttgccaacatcttgatcccttcggcgcagaataaagagctcaagtcgctgctggaa
acgggcatgcctcttgttcaaggaacatccgagcatgccgagcatctagcttcgatgatc
aagtag

DBGET integrated database retrieval system