KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120460Help
Entry
pRL120460         CDS       T00402                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF488
Motif
Other DBs
NCBI-ProteinID: CAK12169
GeneDB: pRL120460
RhizoBase: pRL120460
UniProt: Q1M404
Position
pRL12:complement(494565..494912)
Genome map
AA seq 115 aa AA seqDB search
MALHIKRIYEPKDDKDGTRILVDRLWPRGLSKQDAAVDIWLKDIAPSPTLRRWFGHDPAK
WIEFQRRYRDELEKNPSAVEELKRQIQQADTTLLYAAKDLQHNHAIVLQRFLGKD
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggccttgcacatcaaaagaatctacgagccgaaagacgacaaggacggcacgcgcatc
ctggtcgatcgtctatggcctcgcggattgagcaagcaggatgcagcagtcgatatctgg
ttgaaggatatagcaccaagcccgacgctgcgccgttggtttggccatgatcccgccaaa
tggatcgagttccagcgccggtatcgggacgagttggagaagaatccctccgccgtcgag
gagctgaaacgccagatccagcaagcggacacgacgcttctctacgctgcgaaagaccta
cagcacaatcacgccatcgtgcttcaacgcttcctcggcaaagactga

DBGET integrated database retrieval system