KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120461Help
Entry
pRL120461         CDS       T00402                                 

Definition
(GenBank) putative capsule polysaccharide export protein
  KO
K01991  polysaccharide biosynthesis/export protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
Transporters [BR:rle02000]
 Other Transporters
  Pores ion channels [TC:1]
   pRL120461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Poly_export SLBB
Motif
Other DBs
NCBI-ProteinID: CAK12170
GeneDB: pRL120461
RhizoBase: pRL120461
UniProt: Q1M403
Position
pRL12:495175..496314
Genome map
AA seq 379 aa AA seqDB search
MRKLAPLVLVAVLSACARPSDGPTAGGFYNATAPQSNERIPVVRLSEAPMGPVAATPLAY
AATDPGLSLMRSSGFADTRLRRGDVIEVTILDTGEEGLFSSTQSKTLNLGRFTVDSTGNV
TLPFVGKQRVVDSSTEALQTRIVTGLKGSAVNPQAVVTVVDRPSSGITVNGDVRAAGRFP
LTARKERVLDAVALAGGASSAPGSATVTLMRGKQRATVPLQRVIDDNKQNVYLLPDDQIY
VDKDSPTFTAFGAFKSVGEFEFEPGRLTLAQALGRAGGLLDDRADARNFYVLRSQPVFTQ
VAAANAKTPVPAVVSTKPVIYRVDLKDVSNLALMQRFQMMDGDIIYASNASLVDFAKLFN
VYQKSVPTAAAPIPGSSGN
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagttggcgccgctcgtccttgtcgcagttcttagtgcctgcgcccggccatcg
gatggcccaaccgccggtggtttctataatgccaccgcccctcagagcaacgagcggatt
ccggtcgtcaggctctcggaagcgccgatgggtccggttgcggccaccccgcttgcctat
gcggccaccgatcccgggctcagcctcatgcgctcgagcggatttgccgatacgaggctg
cgacgcggcgatgtcatcgaggtcacgatcctcgacaccggcgaagaggggcttttctct
tcaacccaaagcaagaccctcaatctcggccgcttcaccgtcgattccacgggcaacgtg
acccttcccttcgtcggcaaacagcgcgtggtggattcctcgaccgaggcgctgcagacg
cgcatcgtcaccggcttgaaggggtcggcggtcaatccgcaggccgtcgtcaccgtggtc
gacaggccctccagcggtatcaccgtcaatggcgacgtgcgtgccgccggtcgcttcccg
ctcacagcgcgcaaggagcgtgtactcgatgcggtcgcacttgccggcggcgcatcgtct
gcgccgggctcggcgaccgtcacgctgatgcgcggcaagcagcgcgccaccgtgccgctc
cagcgcgtcatcgacgacaacaaacagaatgtctaccttctgcccgacgaccagatctac
gtcgacaaggattcacccaccttcaccgctttcggcgccttcaagagtgtcggcgagttc
gaattcgagccgggcaggctgacgcttgcccaggcgctcgggcgagccggcggcctgctc
gacgatcgtgccgatgcgcgcaatttctatgtgctgcgcagccagccggtctttacgcag
gttgcggccgcaaatgccaagacccccgtgccggctgtggtgagcaccaagccggtgatc
tatcgcgtcgatctgaaggacgtttccaatctggcgctgatgcagcggttccagatgatg
gatggcgatatcatctacgccagcaacgccagcctggtggactttgccaagctcttcaac
gtgtaccagaaaagcgtgccgacggccgcagcaccgatcccggggtcgagcggcaattaa

DBGET integrated database retrieval system