KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120466Help
Entry
pRL120466         CDS       T00402                                 

Gene name
impJ
Definition
(GenBank) conserved hypothetical protein involved in nitrogen fixation
  KO
K11893  type VI secretion system protein ImpJ
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
KEGG Orthology (KO) [BR:rle00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rle02044]
    pRL120466 (impJ)
Secretion system [BR:rle02044]
 Type VI secretion system
  Imp/Vas secretion system core components [MD:M00334]
   pRL120466 (impJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: CAK12175
GeneDB: pRL120466
RhizoBase: pRL120466
UniProt: Q1M3Z8
Position
pRL12:complement(503601..504941)
Genome map
AA seq 446 aa AA seqDB search
MRNENRVAWSEGMFLRVQHFQQADRWTERLVRTATHGLSPYPWGVAEIGIDRGALAIGQF
ALSNLRGVLPDGTPFEAPVDTDLPPPLDLDENTKNAVVYLALPARQPGKADVALNGGAAR
NSVRLVASPYEAPDANVETDFMAPIDVGRLSLRYLRTGDELAGYELIGLARIIEVRSDRA
VILDPDYIVPSLNCTAAARLGELITELLGIVRHRAEAIAERIGDPTIRGTAEVGDYLLLQ
MLNRADPMLKHISANATRIHPIVFYETCIQLAGELATFTTDRKRASDFPPYRHDDLKATF
AAVFDDLRASLSSVLEQAAVAIELAERRHGVRIGTINDRSLLRDAGFVLAVRAEMPAEDV
RRKLPAQIKIGPVERIADLVNVALPGIPVRPLPVLPRQLPYRSGTIYFELDTKNPLWKQL
DTSGAIAVHLAGDFPGLEIELWALRE
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatgaaaaccgggtggcctggagcgaaggcatgttccttcgcgtgcagcatttt
cagcaggcggaccgctggaccgagcggctcgtgcgcacggcgacgcacggcctgtcgccc
tatccctggggagtggcggaaatcggcatcgaccgcggcgcactggcgatcggccaattc
gcgctgtcgaacctgcgcggcgtattgccggacggaacgccgttcgaagcccctgttgat
accgacctgccgccgccgctcgatctcgacgagaacaccaagaatgcggtcgtctatctc
gcacttcccgcccgtcagccgggcaaggccgatgtggcgttgaacggcggtgccgcgcgc
aacagcgtccggctcgtcgcgtcgccctatgaagcgccggatgccaatgtcgagaccgac
ttcatggcgccgatcgatgtcggccgtctcagcctgcgctatctgaggaccggtgatgaa
ctcgccggctacgaactcatcggacttgcccgtatcatcgaggtgcgttccgacagggcc
gtgatcctcgatccggactatattgtgccgagcctcaactgtacggctgctgcacggctc
ggcgagctgatcaccgaactgctcggcatcgtgcgccaccgcgcggaggccatcgccgaa
cggatcggcgatcccaccattcgagggaccgcggaggtcggcgactacctgctcttacag
atgctcaaccgcgcggatccgatgctgaaacacatttcggcgaatgcgacgcggatccac
cccatcgtcttttacgagacctgcatccagcttgccggcgagctcgccaccttcacgacc
gaccgcaagcgcgcgagcgacttcccgccttaccgccacgacgacctgaaggcgacgttc
gcggccgtcttcgacgatctgcgcgcctcgctgtcatcagtgctcgaacaggcagccgtg
gcgatcgagttggccgaacgccggcatggcgtcaggatcggtacgatcaacgaccgttcg
ctgctgagagatgccggcttcgtactggcggtccgggccgagatgccggccgaagacgtg
cgccgcaagctgccggcgcagatcaagatcggcccggttgagcgcatcgccgacctcgtc
aacgtcgcgctgccgggcatccccgtccggccgctgccggtgctgccacgccagctcccc
tatcgctccggcaccatctatttcgaactcgacaccaagaacccgctttggaaacaactc
gacacttcgggcgccatcgccgtgcatctcgccggcgattttcccgggctcgaaatagaa
ctgtgggcccttagagaatga

DBGET integrated database retrieval system