KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120470Help
Entry
pRL120470         CDS       T00402                                 

Gene name
impF
Definition
(GenBank) conserved hypothetical protein involved in nitrogen fixation
  KO
K11897  type VI secretion system protein ImpF
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
KEGG Orthology (KO) [BR:rle00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rle02044]
    pRL120470 (impF)
Secretion system [BR:rle02044]
 Type VI secretion system
  Imp/Vas secretion system core components [MD:M00334]
   pRL120470 (impF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25 ABATE
Motif
Other DBs
NCBI-ProteinID: CAK12179
GeneDB: pRL120470
RhizoBase: pRL120470
UniProt: Q1M3Z4
Position
pRL12:complement(508938..509447)
Genome map
AA seq 169 aa AA seqDB search
MVDPLERYRLRDRVLARSILDRLIDEAPDRTVDPPISFVDQVRDVREAIRRDLEALLNTR
RCPATPPAALSELKDALVSYGVDGIVSANLMTDQAKLKLAQAIERRIALFETRLSDVRVT
ILKSRTMTERALRMRIQATFSLHEGMPPISFESTIDPSTQRFLVEAAHG
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggttgaccccctcgaacgctaccggctgcgcgaccgcgtccttgcccgctcgatcctc
gacaggttgatcgacgaggctccggatcgcaccgtcgatccgccgataagcttcgtcgac
caggtgcgcgacgtcagggaggcgatccgccgcgatctcgaagcgctgctcaatacgcgg
cgctgcccggccacaccaccggcggcactttccgaactcaaggacgcgctggtgagctat
ggcgtcgacggcatcgtctcggcaaatctgatgaccgaccaggccaagctcaagctggcg
caagcgatcgagaggcggattgcgcttttcgaaacgcggctgtccgatgtgcgggtgacg
atcctcaagagccggacgatgaccgaacgggcgctgcgcatgcgcatccaggcgaccttc
agcctgcatgaaggcatgccgccgatcagctttgagtcgacgatcgatccctcgacccag
cgcttcctcgtggaggcggcgcatggctga

DBGET integrated database retrieval system