KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120477Help
Entry
pRL120477         CDS       T00402                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rle00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    pRL120477
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rle02044]
    pRL120477
Secretion system [BR:rle02044]
 Type VI secretion system
  Imp/Vas secretion system core components [MD:M00334]
   pRL120477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: CAK12186
GeneDB: pRL120477
RhizoBase: pRL120477
UniProt: Q1M3Y8
Position
pRL12:517603..518079
Genome map
AA seq 158 aa AA seqDB search
MPIYLQIDGIQGDATHEQHRKWMDIEAIHWNVARNMNTSAGSAANREASEPTVSEVILTK
VSDSSSTKLFQEACSGRTGKRSVIHLVTTGNPGDTYIEYSLENTLIASYSIDSNGDRPVE
TIKLNFTKMEVKYTPYDDKHSPQSPMIASYDLATTKAA
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgccgatttatcttcagatcgacggtatccagggggatgctacccacgagcagcatcgc
aaatggatggatatcgaagccatccactggaatgtagcccgcaacatgaacacgtccgct
ggttcggcggcgaaccgtgaagcttccgagccgaccgtttcggaagtgatcctcaccaag
gtcagcgactcctcgtcgaccaagcttttccaggaggcctgctcgggccgtaccggcaag
cgctccgtcatccatctcgtcaccacgggcaatcctggcgacacctatatcgagtactcc
ctcgaaaatacgctgatcgccagctactcgatcgattccaacggcgaccgcccggtcgag
acgatcaagctgaacttcaccaagatggaagtgaagtacacgccttacgacgacaagcac
tcgccgcagtcgccgatgatcgcttcttacgatctcgcgaccaccaaggccgcttaa

DBGET integrated database retrieval system