KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120480Help
Entry
pRL120480         CDS       T00402                                 

Definition
(GenBank) putative fimbrial operon related protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rle00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    pRL120480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rle02044]
    pRL120480
Secretion system [BR:rle02044]
 Type VI secretion system
  Imp/Vas secretion system core components [MD:M00334]
   pRL120480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Gp5_C
Motif
Other DBs
NCBI-ProteinID: CAK12189
GeneDB: pRL120480
RhizoBase: pRL120480
UniProt: Q1M3Y5
Position
pRL12:520276..522540
Genome map
AA seq 754 aa AA seqDB search
MDDLQSLAADFIQANRILKIVSPLGEDQLLPERVTIEEGISSLFEIRLSARAKKPSVKPE
ELIGRLMDVSVEVQQGDDGGGVRRPFNGLVTELNEGPPITRGLRSYSMVLRPQMWLLSRR
SDCRIWMDKTAVDIVETLFSEHGIPAPDTSGVITPPPPQHYSVQWNETDLAYLTRRFEED
GLFYWFSHEDGKHKLHVADGARSWLGPSPSAQGEGRVRLAQGSSDRNHINEWSRRYSYVP
GQRAGADWNFETPRMVPGTMTPSLVQMPEATKRELYEYPARISSVTEAERAEKLRMQASE
ADHDRVFGASTSRILEAGRRFTPYEVAHPDHVYEEHVVVKAVHTVVDRSYETNSNEPEYT
NTFEAVPSRVAMTPHRETKRPRIEGTQVAIVAGPSGEEIHPDQYGRIKLWFPWDRKAKKD
GSDTCWVRVSQVWGGGTWGAQVIPRIGMEVMVAFVDGDPDRPLVTGVVPNPSNAVPYDLP
ANKTRMVMRSNTHKGTGFNEMTFEDESGQENMFFHAQKDQTTRVLNDRTKRIDRHEVSAI
GANRTVEVGGNQKHEVGGSMNTVVGGTGPMAMALMGAVSGLSGHTAGLLAQAGQIAGGGG
PGLAAFAGTLASSALGFLGAGGLGSREGVVSGPSPRADAGTALAGSGTGVGDAASGLFPL
PGIMNTIVGSFKSDTIGIARAEQIGVSKVTNVGQTSLESVGKFKKIAVGEEFVIECGDSK
FIMKANGEVIILGKTFNFVATEHFQMRGKPIDLN
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggacgatttgcaatccctcgccgcggatttcatccaggcgaaccgtattctgaagatc
gtctcgccgctcggcgaagaccagcttctgccggagcgggtgacgatcgaggaaggtatt
tcctcgctctttgaaatcaggctttcggcccgcgccaagaagccgtccgtcaagccggag
gaactgatcggccggctgatggatgtctccgtcgaggtgcagcagggtgacgatggcggc
ggcgtgcgccggccgttcaacggcctggtgaccgaactcaacgaggggccgcccatcacc
cgcggcctcagatcctattccatggtgctgcggccgcaaatgtggctcctttcgcgccgt
tccgactgccgcatctggatggataagaccgcggtcgatatcgtcgagacgctgttttcc
gagcacggcatcccggcgccggatacctcaggcgtgatcacaccaccgccgccgcagcat
tattcggtgcagtggaacgaaacggacctagcctatctcacccgccgtttcgaggaagac
ggcctgttctattggttctcccatgaggacggcaaacacaagctgcatgtggccgatggt
gcaagatcctggctcggtccgtcgccctcggcgcagggtgaggggcgggttcgcctcgcg
caaggctcctcggatcgcaaccatatcaacgagtggagccggcgctattcctatgtgccg
ggccagcgggcaggcgccgactggaatttcgaaacgccgcgcatggtgccgggcaccatg
accccgtcgctggtgcagatgccggaagcgaccaagcgcgagctttacgaatatccggcg
cgcatttcttccgtgaccgaggcggagcgggcggaaaaactcaggatgcaggcctccgaa
gcagatcacgaccgggtcttcggcgcctccacatcccgcattctggaggcggggcgccgc
ttcaccccctatgaagtcgcccatcccgaccacgtctatgaggaacatgtggtggtcaag
gcggtgcataccgtcgtcgaccgttcctacgagacgaacagcaacgagccggaatacacg
aacacattcgaggcggtgccgtcgcgggtggcgatgacgccgcatcgcgagacgaaacgg
ccgcggatcgagggcacccaggtggcgatcgtcgccggcccttccggcgaggaaatccat
cccgaccagtacggtcgcatcaagctgtggttcccttgggatcgcaaggccaagaaggac
ggttccgacacctgctgggtgcgcgtcagccaggtctggggaggcgggacctggggcgcc
caggtcatcccgcgcatcggcatggaggtgatggtcgccttcgtcgacggcgatcccgac
cggccgctggtgacgggcgtggtgcccaatcccagcaatgcagttccttacgacctgccg
gccaacaagacgcgtatggtcatgcgctcgaacacgcataagggcactggcttcaacgag
atgacgttcgaagacgagtctggccaggaaaacatgttcttccatgcgcagaaggaccag
acgacgcgcgtactgaatgaccgcaccaagcgcatcgatcgccacgaagtttcggcgatc
ggcgccaaccgaacggtcgaagtcggcggcaaccagaaacacgaagtcggcggttcgatg
aacaccgtcgtcggcggcacggggccgatggcaatggcgcttatgggggctgtcagcggt
ctttccggacatacggccgggctgctggcgcaggctgggcaaattgcaggcggcggtggg
ccggggcttgccgcctttgccggcacgcttgcgtcgtcggcgcttggtttcctaggcgcc
ggtggtcttggcagccgtgaaggggtcgtctcggggccaagcccgcgcgccgatgccggt
acggcacttgccggttcagggaccggtgtgggcgatgccgcctccggcctgtttccgctg
cccggcatcatgaacaccatcgtcggctcgttcaaatccgacacgatcggcatcgcccgc
gccgagcagatcggcgtcagcaaggtgaccaatgtcggccagacatcgctggagagcgtc
ggaaaattcaagaagatcgccgtcggcgaggaattcgtcatcgaatgcggcgattccaaa
ttcatcatgaaggcgaatggcgaagtgatcatcctcggcaagacgttcaacttcgtcgcc
accgaacacttccagatgcgcggcaagccgattgatctgaactga

DBGET integrated database retrieval system