KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120483Help
Entry
pRL120483         CDS       T00402                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Reg_prop
Motif
Other DBs
NCBI-ProteinID: CAK12192
GeneDB: pRL120483
RhizoBase: pRL120483
UniProt: Q1M3Y2
Position
pRL12:525159..526274
Genome map
AA seq 371 aa AA seqDB search
MMNGSDWKATIQAAVAFDVDRFAICVGELEYDDPFTAIISYDGRFSQPWSRTDVQREIVD
ISYMGADPTEDHVPVALSNEGDVYVLKDEHAERSKIPGAGILSEDAEGFGAVHTLVVDGH
SQYVVGDSRQLYRREGFGTWQRLSANKSREDGYEAEHFGKAISLDGSLIVESVQRPYSAP
SAAQLDPKSWENVSPEQFLKMMKEQRSERVTRPRIQRVYHYLDGGFSRLSLPEDCVIRGL
YRDPEQRIWFLGGGGLILQGTIEGGFEKVGFLGDTETLFSAAWCRSELFAATDDGLRRFD
GHKLGIVKPKLNSAAINRNIPAPLKIQSFDNTLIYFDRKHGVCRWDGQSWDWYEIPPSLL
QREFKGLPARQ
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaacggcagtgactggaaggcaacaattcaagccgctgtggcgtttgatgtcgac
cgctttgcgatatgtgttggcgagcttgaatacgatgatccatttactgcgatcatttct
tatgatgggcgattttctcagccgtggagcagaacggatgttcagcgcgagatcgtcgat
atcagctatatgggagccgatcctacggaagaccatgtcccggtagcgctcagcaacgag
ggcgacgtctatgtgttgaaggacgagcatgcggagcgatcgaagatccccggagctggg
attctcagcgaagatgctgagggttttggggcagtccatacgctggtcgtagatggacat
agccaatatgttgtcggggatagccgtcaactctatcgcagagagggctttggaacatgg
caacggctttctgcgaacaaatcccgcgaggacggttatgaggccgaacattttggaaag
gcgatttccttggacggttcgctcatcgtcgaaagtgttcaaagaccttattctgcacca
agcgctgcgcagctcgatcccaaaagctgggaaaatgtcagcccggagcagttcctgaag
atgatgaaggaacaacggtccgagcgcgttacaaggccacgcatccaacgcgtgtatcat
tatctcgacggcggtttctcacgattatccctccccgaagattgcgtgattagagggcta
taccgcgacccggagcagcgtatttggtttttgggcgggggaggtctgatcctgcaggga
accatcgaaggaggatttgagaaggtcggcttcctcggggatacggaaacgttgttcagt
gccgcgtggtgtcgttcggagctttttgcggccacagacgacggtcttcgccgatttgac
ggccataagcttggcatcgtgaaacccaaactaaattccgcagctataaaccgaaatatt
cctgcacctctgaaaattcaatctttcgataacacgctgatatatttcgacaggaagcat
ggcgtgtgcaggtgggacgggcaatcctgggattggtacgagatcccgccgtcacttctg
caacgcgagttcaaaggcttgcctgccagacaatag

DBGET integrated database retrieval system