KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120502Help
Entry
pRL120502         CDS       T00402                                 

Definition
(GenBank) putative guanylate/adenylate cyclase
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc
Motif
Other DBs
NCBI-ProteinID: CAK12211
GeneDB: pRL120502
RhizoBase: pRL120502
UniProt: Q1M3W3
Position
pRL12:complement(543845..545251)
Genome map
AA seq 468 aa AA seqDB search
MSEVDVLFASLRQAADPQTVECIENVVTHGSDRELNRINALAFADKHDLDQEKTIAAFLH
AARIGAFEMTWNVLCPGCGGVLDSGATLKTVVHETYHCALCAAGYEPTLDEMVEVTFTVS
PRVRRIAGHDPDRLPPLEYYRQIFFSTGVDLPDDLEARFSRIQLEMIELAPGEKAFVSLQ
LPAQFVIIFDPVTHSAQFIDVQGEPTDERQTLSMIISRTHALNETLTLRPGSLRLTLENH
TDRRVVPNVCIAGEELHDLLGRRRPFLTAKRLLTNQSFRDIYRTDTLDVDQRLKITSLTF
LFTDLRGSTALYERVGDLAAFDLVRAHFRVLHEIVATEAGAVVKTIGDAVMATFPSPDRA
VAAALKMREAMLRLNAEHGSDDLLLKIGIHEGPCLAVNLNDRQDYFGQTVNIASRVQGLA
DPNVIMTTEAIVEDAQVSEILRDSGITSASRMAELQGIGREVRIFALS
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagtggacgtcctttttgcctccctgcgacaggcggctgacccgcagacggtc
gagtgcatcgaaaacgtcgtcacgcatggctcggatcgtgaactcaatcgcatcaatgcg
ctcgctttcgccgataagcatgatctcgaccaagagaaaaccatcgccgcgtttcttcat
gcagcccgcataggcgcattcgagatgacctggaatgtcctttgcccgggatgcggcggc
gtcctcgacagcggcgcaaccctcaaaaccgttgtccacgagacgtaccattgcgcgctc
tgcgccgccggatacgaaccgaccctcgacgagatggtcgaggtcacgttcacggtcagc
ccgcgcgtgcgcaggattgccggtcacgatcctgatcggttgccgccgctcgagtactac
cgccagatcttcttcagcaccggggtcgacctgcctgacgatctcgaagcaaggttttcg
cgcatccagctggagatgatcgagttggctccgggcgaaaaggccttcgtctccctgcaa
ctgccggcgcagttcgtcatcatcttcgatccggtgacacactcggcgcagttcatcgac
gtgcagggtgagcccaccgacgaacgtcaaaccctctcgatgatcatcagtcggacgcat
gcgctgaacgaaacgctgaccctgcgtcctggctcactgcggctcacgcttgagaaccac
accgatcgcagagtggtgccgaacgtctgcatcgcaggagaagagctgcacgacctgctg
ggccgcaggcggccttttctgacagccaagcggctgctgacgaaccagagcttccgcgac
atctatcggaccgacacactcgacgtcgaccagcgcctcaagatcaccagcctgaccttc
ctcttcaccgacttgaggggctcgaccgcgctttacgagcgcgtcggagatcttgccgcc
ttcgatctggtgcgggcgcatttccgggttcttcacgagatcgtcgccacagaggccgga
gccgtcgtcaagaccataggcgatgccgtgatggccaccttcccgagcccggaccgtgcg
gtggcggcggcactcaagatgcgggaggcgatgcttcggctgaatgccgaacacggcagc
gacgaccttctcctgaagatcggcatccatgagggaccatgcctcgccgtcaacctgaac
gaccggcaggactacttcggccaaaccgtcaatatcgcttcccgcgtccagggccttgcc
gatcccaatgtgatcatgacgacggaggcgatcgtcgaggatgcccaggtttcagagatc
ctgcgcgacagcggcatcacatcggcctcccggatggcggaacttcagggcatcgggaga
gaggtgaggatttttgcactgtcgtga

DBGET integrated database retrieval system