KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120504Help
Entry
pRL120504         CDS       T00402                                 

Gene name
fcS
Definition
(GenBank) putative feruloyl-CoA synthetase
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
KEGG Orthology (KO) [BR:rle00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rle01004]
    pRL120504 (fcS)
Enzymes [BR:rle01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     pRL120504 (fcS)
Lipid biosynthesis proteins [BR:rle01004]
 Acyl-CoA synthetase
  Unknown
   pRL120504 (fcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CAK12213
GeneDB: pRL120504
RhizoBase: pRL120504
UniProt: Q1M3W1
Position
pRL12:546084..547649
Genome map
AA seq 521 aa AA seqDB search
MASSADCGLVTDDPILYRARVAPGRPALFEIATGRQLTYAELDARIACCAGLLSDVLGAR
RDGARVAMLARNSVDSIVLAFACQRAGAIYVPLNWRLNAAELRPILADCAPALLVHDEEF
AATVANLAGADPEMAVISMADGPAGFAARIEASLPAAPVPADADGPCVLLYTSGTTGQPK
GVVITRRNAFFAAINFSVVGEIGPRSVALCDLPFFHTIGLIAVARTTLMLGGTLVVSDRF
TPARTLAALADRQRAITHYFAVPQIALALRNDPAYSAAALAGLHALFVGGAPLTQALIES
YLDDGVALVNGYGMSEAGTVLHVPIDRRAVQDNPGSVGLPAPLLDIRIVDEDGREVDEGE
IGELWLRGPAVTPGYWNKPEETAAAFTDGWYRTGDLGRREANGFYRIVDRLKDMYISGGE
NVYPAEVEAALASHPDILDAAVVGIPDIRWGECGVAYVVLRPGAAATGDEIAGHCAARLA
AFKRPARILFVEAIPRTASGKVQKHVLRQFHSDETLQRQAL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgtcggcggattgcggactggtgacggatgatccgatcctttaccgcgcccgc
gtcgcaccgggccgtccggctctgttcgagatcgctaccggccggcagctcacctatgcc
gaactcgatgcgcggatcgcctgctgcgcgggcttgctgagcgatgtgcttggagcgcgc
cgcgacggggcgcgtgtcgccatgctggcgcgcaactccgtagattcgatcgtgcttgcc
tttgcctgccagcgtgccggcgccatctacgtgccgctcaactggcgcctcaacgccgcc
gagcttcggccgatccttgccgattgcgcgccggctctgctcgttcacgacgaggagttc
gcggcaaccgtcgccaaccttgcgggcgccgatcccgagatggcggtgatatcgatggcc
gacggcccggccgggttcgccgcgcggatcgaagcgagccttccggccgctccggtgccc
gccgatgccgatggaccctgcgtccttctctacacctcgggcacgacggggcagccgaag
ggcgtcgttatcacccgccgcaacgcctttttcgccgctatcaacttttccgtcgtcgga
gagatcgggccgagatccgtcgcgctttgcgacctgccgttcttccacacgatcgggctg
atcgcggtggcgcgtaccacattgatgctgggcggcacgcttgtcgtctccgaccgcttc
accccggcgcgcacactcgcagcccttgccgaccgtcagcgtgccatcacccattatttc
gccgtgccgcagatcgcgctcgccttgcgcaacgatccagcctatagcgccgcggctctg
gccggcctgcatgcgctcttcgtcggcggcgcgccgctgacgcaggcgctgatcgaaagc
tatctcgatgacggcgttgcgctggtcaacggttacggcatgagcgaggccggaacggtg
ctgcacgtgccgatcgaccggcgcgccgtgcaggacaatcccggcagcgtcggtcttccg
gcgccgttgctcgacattcgcatcgtcgacgaggacggccgcgaggttgatgaaggcgag
atcggcgaactctggctgcgcgggccggccgtgacgccgggctactggaacaagcctgag
gaaaccgctgccgccttcaccgacggctggtaccgcaccggcgatctcggccgacgcgaa
gcgaacggcttctatcgcatcgtcgaccggctgaaggacatgtacatcagcggcggcgag
aatgtttaccccgccgaggtcgaagcagcactcgcaagtcatcccgatatcctcgatgcg
gcggtcgtcggcattcccgatatccgatggggcgaatgcggcgtcgcctatgtcgtgctg
cggccgggtgctgcggcaacgggcgatgagatcgccggccattgcgcggcaaggctcgcc
gccttcaagcgtccggcgcgcatcctcttcgtcgaggccattccccgcaccgcctccggc
aaggtgcagaaacatgtcctgcgccagttccattccgacgaaacccttcaacgacaggcc
ctgtga

DBGET integrated database retrieval system