KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120506Help
Entry
pRL120506         CDS       T00402                                 

Definition
(GenBank) putative aryl-alcohol dehydrogenase
  KO
K00055  aryl-alcohol dehydrogenase [EC:1.1.1.90]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00350  Tyrosine metabolism
rle00360  Phenylalanine metabolism
rle00622  Xylene degradation
rle00623  Toluene degradation
rle01100  Metabolic pathways
rle01120  Microbial metabolism in diverse environments
rle01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    pRL120506
   00360 Phenylalanine metabolism
    pRL120506
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    pRL120506
   00622 Xylene degradation
    pRL120506
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.90  aryl-alcohol dehydrogenase
     pRL120506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C TrkA_N Urocanase Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: CAK12215
GeneDB: pRL120506
RhizoBase: pRL120506
UniProt: Q1M3V9
Position
pRL12:548573..549679
Genome map
AA seq 368 aa AA seqDB search
MKIHAAVARAPHTPFSLERLDLEEPREGEILVRVVATGVCHTDIVMRDQHLPVPQPVVLG
HEGAGIVERVGPGVAKVKPGDHVVMTFNSCGHCPSCNDHQETYCHEFFPRNFFGARADGS
SGLSCEGVRVHGNIFGQSSFASHALCHERNIVKVPEDADLALLGPLACGIQTGAGAVMNA
LKVEPGKVLAVFGMGSVGLAAVMAARIVGASRIIAVDVNETRLALAAELGATDIVNGKAS
DAVAAIMALTGAGVDYSIDASGVPAVIDQCVRVLAPRGTCGIVGASPHGATLTLDLTHIL
SGGRRVRGIVEGDSNPDVLIPLLIDLHRQGRFPFDRLITFYDFADINQAVEDSEKGIVLK
PVVRQPAV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccatgccgcggtggcgcgtgcgccccatacgccgttttcgctggaaaggctc
gatctggaggagccacgtgagggtgaaatcctggttcgcgtcgtggcgacaggggtttgc
cacaccgatatcgtcatgcgtgaccagcacctgccggtgccgcagccggtcgtgctcggt
catgaaggcgccggcatcgtcgagcgtgtcgggccgggcgttgccaaggtcaagcccggc
gatcacgtggtcatgaccttcaattcctgcggtcattgcccgagctgcaacgatcaccag
gagacctattgccacgaattcttcccgcgcaacttcttcggtgcgcgtgccgatggttcg
agcgggctctcatgcgagggagtgcgggttcacggcaatattttcgggcaatcctccttc
gccagccacgcgctgtgccatgagcgcaatatcgtgaaagtgcctgaggatgccgatctg
gcgttgctcgggccgctcgcctgcggcatccagaccggcgccggcgcggtcatgaacgcg
ctgaaggtcgagccgggaaaggtgctcgcggttttcggcatgggctccgtcggccttgcc
gcggtgatggcggcgcggatcgtcggcgcttcacggatcatcgccgtcgatgtcaacgag
acgcggctggcacttgcggcggaactcggcgcgaccgacatcgtcaacggcaaggcgagc
gacgcggttgccgcaatcatggcgctgaccggcgccggcgtcgattattcgatcgatgcc
tccggcgtgccggccgtcatcgaccaatgcgtgcgggtgctggcgccgcgcggcacctgc
ggaatcgtcggggcctcgccccatggcgcgacgctgacgctcgacctcacccatatcctg
tccggcggacgccgggtccgcggcatcgtcgagggcgattccaatcccgacgttttgatc
ccgttgttgatcgacctccatcggcagggccgcttccccttcgacaggctcatcaccttc
tatgatttcgccgacatcaaccaggcggtggaggattcggaaaagggcatcgtgctgaaa
ccggtcgtgcgtcagccggccgtctga

DBGET integrated database retrieval system