KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120507Help
Entry
pRL120507         CDS       T00402                                 

Gene name
calB
Definition
(GenBank) putative coniferyl aldehyde dehydrogenase
  KO
K00154  coniferyl-aldehyde dehydrogenase [EC:1.2.1.68]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
KEGG Orthology (KO) [BR:rle00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    pRL120507 (calB)
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.68  coniferyl-aldehyde dehydrogenase
     pRL120507 (calB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CAK12216
GeneDB: pRL120507
RhizoBase: pRL120507
UniProt: Q1M3V8
Position
pRL12:549701..551140
Genome map
AA seq 479 aa AA seqDB search
MNTITAIATDTSPDVMKALLDRQRASFLKEGPPSIDTRIDRIDRVIALLVDHKDAIAAAL
SEDFGSRSVEASLLLDVFTCVGSLKYAKAHLAEWLKPEQHEALFPDAVAEVVYQPKGVVG
ILSPWNFPYQLALAPLAGILAAGNRAMIKPSEVTPASAALMAELIAGAFDETEIAVVQGG
PSAGTAFTSLAFDHLIFTGGTAVAHHVMRAAADNLTPLTLELGGKSPVIVGRSADLADAA
RRVMTVKTLNAGQICLAPDHVYVPEESVEAFAGHAVAAVGAMYPALQENPDYTSIVNARH
LARIEGLIDDARAKGARIVEINPAAENFSQQSAHRMPPTLILDPTEEMRVLQEEIFGPVL
PVVPYRDIADVIDRINARPRPLALYYFSQDQQEEARVLDNTTSGGVTVNDCMSHVTAEGL
PFGGVGHSGMGAYHGKFGFLAFSHPRAVYHQSRMVEAEYMMRPPYGDAMRGFLAAAICK
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccatcaccgcaatcgccaccgataccagccccgatgtcatgaaggcgctgctt
gaccggcaaagggcgtctttcctgaaggaagggccgccaagcatcgacacccgcatcgat
cgcatcgaccgcgtcatcgctcttctcgtcgaccataaggatgcgatcgccgctgccctg
tcggaggacttcggcagccgcagcgtcgaggcgagcctgcttctcgatgtctttacctgc
gtcggttcgctcaaatatgccaaggcccatcttgccgaatggctgaagcccgagcagcac
gaggcattgttcccggacgcggtggccgaagtggtctatcagccgaagggggttgtcgga
atcctcagcccgtggaatttcccttatcagctcgccctggcgccgcttgccggcattctt
gccgccggcaaccgcgccatgatcaagccgtcggaggtgacgccggcctcggccgccttg
atggcggaactcattgccggcgccttcgacgaaaccgaaatcgctgtcgttcagggcgga
ccgtcggcgggcacggcctttacttcacttgccttcgaccatctgatcttcaccggcgga
accgcggtcgcccatcacgtcatgcgcgcggcggcggataacctgacgccgctgacgctc
gagctcggcggcaagtcgcccgtcatcgtcggccgctcggccgacctcgccgacgcggcg
cgccgcgtcatgaccgtcaagacgctgaacgccggccagatctgccttgcgccggaccat
gtctatgtgcccgaggaaagcgtcgaggcctttgccggccacgcggtcgcggcggtcggc
gcgatgtatccggcgctgcaggaaaatcccgattacacctcgatcgtcaatgcccgccat
ctcgcccgcatagagggcctgatcgacgatgccagggccaagggcgcgaggatcgtcgag
atcaacccggcggcggagaatttctcccagcaatcggcgcaccgcatgccaccgaccctg
atcctcgatccgacggaagagatgcgcgtgctgcaggaggaaatcttcggacccgtgctg
ccggtcgtgccctatcgcgatatcgccgacgtcatcgatcgtatcaatgccaggccgcgc
ccgctcgctctctattacttcagccaggatcagcaggaggaggcccgcgtcctcgacaat
acgacctccggcggggtgacggtcaacgactgcatgagccacgtcacggcggaaggcctg
cccttcggcggcgtcggccattcgggcatgggcgcctatcacggcaaattcggcttcctc
gccttctcgcacccgcgcgccgtctatcaccagagcaggatggtggaagcggaatacatg
atgcggccgccctatggcgatgcgatgcgtggcttcttggcggcagcgatctgcaagtaa

DBGET integrated database retrieval system