KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120514Help
Entry
pRL120514         CDS       T00402                                 

Gene name
qatV3
Definition
(GenBank) putative ATP-binding component of ABC transporter
  KO
K02000  glycine betaine/proline transport system ATP-binding protein [EC:3.6.3.32]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02010  ABC transporters
Module
rle_M00208  Glycine betaine/proline transport system
Brite
KEGG Orthology (KO) [BR:rle00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    pRL120514 (qatV3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rle02000]
    pRL120514 (qatV3)
Enzymes [BR:rle01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.32  quaternary-amine-transporting ATPase
     pRL120514 (qatV3)
Transporters [BR:rle02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter [MD:M00208] [OT]
    pRL120514 (qatV3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_ATPase AAA_22 ATPase_2 AAA_21 RsgA_GTPase AAA_16 AAA_29 SMC_N AAA_30 CBS Viral_helicase1 AAA_18 Adeno_IVa2 AAA_23 AAA_33 APS_kinase
Motif
Other DBs
NCBI-ProteinID: CAK12223
GeneDB: pRL120514
RhizoBase: pRL120514
UniProt: Q1M3V1
Position
pRL12:complement(559028..560107)
Genome map
AA seq 359 aa AA seqDB search
MADQRFGGIKIRHLYKIFGPNPGAHVDAVKKGLSKTELNEKHGHVLGLKDINVEIPSGRI
QVIMGLSGSGKSTLIRHINRLIDPTAGEVLVDGVDVVKMNETELRTFRRHQTAMVFQKFA
LLPHRNVLDNTIFGREVQGMERSKAVDVAMGWLERVGLKGFESKYPNQLSGGMQQRVGLA
RALSNDAPVLLMDEAYSALDPLIRTDMQTVLLDIQKEIKKTIVFITHDLDEALRLGDQIA
ILRDGEVIQQGTSQDIVLRPADAYIANFVKEVNRGRVIQVDAIMTSLHSGAVPGGLTIAS
GTTVEDAVRILASAAHDDARVVSPSGEALGLVTFRQLAGAMVNSQEVAPRRDSALSVAL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcaacgtttcggcggcatcaagatccgccacctctacaagatcttcggtccc
aatcctggcgctcatgtcgatgccgtcaaaaaaggattgtcgaagaccgagctcaacgaa
aagcacggccacgtgctcggcctgaaagatatcaatgtcgagataccctcgggccgcatc
caggtcatcatgggcctttcgggttcgggcaagtcgacgctcatccgccacatcaaccgt
ctgatcgatccaaccgccggcgaagtgcttgtcgacggcgtcgatgtggtgaaaatgaac
gagaccgaattgcggacgtttcgccggcaccagacggcaatggtgtttcagaagttcgcg
cttctgccgcaccggaatgttctcgacaataccatcttcggccgcgaagtgcagggcatg
gagcgctcgaaagccgttgacgttgccatgggctggctggagcgggtcggcctgaagggc
ttcgagagcaaatatcccaaccagctatcgggcggtatgcagcagcgcgtcgggctggca
cgagccctctcgaacgatgcgccggttctgctgatggacgaggcctattcggcgctcgat
ccgttgatccgcaccgatatgcagacggtccttctcgacattcagaaggagatcaagaag
accatcgtcttcatcacccacgatcttgacgaagcccttcggctgggcgaccagattgcg
atcctgcgcgatggcgaagtcatccagcagggcaccagccaggacatcgttctgcgtccg
gccgacgcctacatcgccaacttcgtcaaggaggtcaatcgaggccgggtcatccaggtc
gatgccatcatgacatccttgcattccggtgcggtgccaggcggattgacgatcgcatcc
ggcacgaccgtcgaagacgccgtccggatcctggcatcggcggcgcacgacgatgccagg
gtggtttcaccatctggggaagcactggggcttgtcaccttccgccagctcgcgggcgcg
atggtgaactcgcaggaggtggccccccgacgcgacagcgccctctcggtcgcactttga

DBGET integrated database retrieval system