KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120518Help
Entry
pRL120518         CDS       T00402                                 

Definition
(GenBank) putative TetR family transcriptional regulator
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N
Motif
Other DBs
NCBI-ProteinID: CAK12227
GeneDB: pRL120518
RhizoBase: pRL120518
UniProt: Q1M3U7
Position
pRL12:complement(563071..563700)
Genome map
AA seq 209 aa AA seqDB search
MDQALNDTGWRGSQEGWLEAAYHSLLDSGVDSVKILPLAKKLNLSRTSFYWFFKDREELL
AGLVARWRDKNTGNIVKQSEAYAESLAEAMLNVFDCWLNNDLFDARFEFAVRSWALQSDE
ILAEVRQADQLRLDALKRMFIRFGLPEATSDVRARTTYLVQIGYISMQAKEELAVRMKRI
PEYIAIYTGEVPQQRELDRFFSRHGYRPG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggcattgaacgacaccggctggcgcggatcacaggagggatggctggaagca
gcttaccactcgttgctggattccggcgtggattcggtgaaaattctgccgctggcgaag
aagctcaacctctcgcgcacgagtttctactggttcttcaaggaccgggaggaactgctg
gccgggctcgtggcgcggtggcgcgacaaaaacaccggcaatatcgtcaagcagtccgaa
gcctacgccgaatcgctcgccgaggcgatgctcaacgtcttcgactgctggctcaacaat
gatctgttcgacgccaggttcgaattcgcagtgcgcagttgggcgctgcagtccgacgag
attctcgccgaggtccggcaagccgaccagcttcggcttgatgcgctcaagcgcatgttt
atccgcttcgggctaccagaagcgacatcggatgtccgagcgcgaacaacttacctcgtg
cagatcggatacatctccatgcaagccaaggaggaactcgccgtccgcatgaaacggatt
cccgaatatatcgcgatctacaccggcgaagtgccgcagcagagggagctcgatcgcttc
ttctcccggcatggctacaggccgggttag

DBGET integrated database retrieval system