KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120519Help
Entry
pRL120519         CDS       T00402                                 

Definition
(GenBank) putative flavoprotein oxidoreductase
  KO
K22551  N-methyl-L-proline demethylase [EC:1.5.3.-]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.-  
     pRL120519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN Pyr_redox_2 NAD_binding_8 Pyr_redox HI0933_like Thi4 GIDA FAD_binding_2 AlaDh_PNT_C FAD_binding_3 Pyr_redox_3 DAO FAD_oxidored NAD_binding_7 Phage_Coat_B GFO_IDH_MocA NAD_binding_9 FMO-like 2-Hacid_dh_C 3HCDH_N Lycopene_cycl Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: CAK12228
GeneDB: pRL120519
RhizoBase: pRL120519
UniProt: Q1M3U6
Position
pRL12:563849..565885
Genome map
AA seq 678 aa AA seqDB search
MSNDPLLQPYQLKHLTLRNRIIVTSHEPAYPEDGMPKERYRAYTVERAKGGVALAMTAGS
AAVSRDSPPVFNNLLAYKDEIVPWIREMTDAVHEEGAAIMIQLTHLGRRTRWDKGDWLPV
VAPSHHREASHRSFPKKMEDWDIERIIKDFADAAERMKAGGMDGVELEAYGHLIDQFTSP
LTNELDGPYGGSLDNRLRFCLDVFKAIRQRVGNDFILGVRYTADECLPGGTGKGDGIEIS
KRLKESGLIDYLNVIRGHIDTDAGLTDVIPIQGMASSPHLDFAGEIRAATDFPTFHAAKI
PDVATARHAIASGKVDMVGMTRAHMTDPHIVRKIIEKREDDIRPCVGANYCLDRIYQGGA
AFCIHNAATGRELTMPHIVAKAEAKKKVVIVGAGPAGLEAARVAGERGHQVVVFEAANNP
GGQIRLTAQSERRREMISIIDWRMSQCEKYDVTFHFNTWAEADTIAAENPDVVIIATGGL
PHTEVLASGNELVVSSWDIISGDVKPGTNVLIFDDAGDHAGLQAAEFLAKAGAKVEIMTP
DRSFAPEVMAMNLVPYMRSLQKHDVTFTVTYRLEAVEKSGNQLVAHIGSDYGGIARQHSF
DQIVVNHGTIPLDDLYFELKPSSSNLGEMSHDQLLSGEPQSVIRNPDGKFQLFRIGDAVA
ARNTHAAVYDGLRIAKDI
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgatccccttcttcagccctatcaactcaagcatttgacgctacgcaaccgt
atcatcgtgacctcccacgaaccggcctatccggaagacggcatgccgaaggagaggtat
cgcgcctatacagtggagcgggcaaagggcggtgtggccttggcgatgacggcaggctcg
gccgcggtttccagggacagcccgccggtcttcaacaacctgctcgcctacaaggacgaa
atcgtgccctggatcagggaaatgaccgacgccgtgcatgaagagggtgcggcgatcatg
atccagctcacccatctcggccggcgcacgcgctgggacaagggcgactggctgccggtg
gtggcgccgtcgcatcatcgcgaggcttcccaccgctccttcccgaagaagatggaagat
tgggacatcgagcgcatcatcaaggatttcgccgacgctgccgagcgcatgaaggcgggc
ggcatggacggtgtcgaactggaagcctatggccacctgatcgaccagttcacgtcgccg
ctcaccaacgagctcgacggtccctatggcggctcgctcgataaccgtttgcgcttctgc
ctcgatgtgttcaaagcgatccggcaaagggtggggaacgacttcattctgggcgtgcgc
tacaccgccgacgaatgtcttcccggcggcaccggcaagggcgacggcatcgaaatctcc
aagcgcctgaaagaaagcggcctgatcgactacctcaatgtgatccgcggccacatcgat
accgatgcgggtctcaccgacgtgatcccgatccagggcatggcgagttcaccgcatctc
gatttcgccggcgaaattcgcgccgcaaccgatttcccgaccttccatgccgcgaaaatc
cctgacgtcgctaccgcgcgccacgcgatcgcctccggcaaggtcgacatggtcggcatg
acccgcgcccacatgaccgacccccacatcgtccgcaagatcatcgaaaagcgcgaagac
gatattcgaccctgcgtcggcgccaattactgtctcgatcgcatttaccagggtggggcc
gccttctgtatccacaatgccgccaccggccgcgaactgaccatgccgcatatcgtggcg
aaggctgaggccaagaaaaaggtcgtcatcgtcggcgccggcccggccggtctggaagcg
gcgcgcgtcgccggagaacgcggccaccaggtcgtcgttttcgaagcggcgaacaatccc
ggcggccagatccgcctcaccgcccagagcgagcgccgcagggagatgatcagcatcatc
gactggcgcatgagccagtgcgagaaatacgacgtcaccttccacttcaacacctgggcg
gaggccgataccatcgcggccgaaaatcccgatgtcgtcatcatcgcgaccggcggcttg
ccgcataccgaggttctcgccagcggcaacgagctggtggtctcgtcatgggacatcatc
tccggcgacgtgaagcctggaaccaatgtgctgatcttcgacgatgccggcgaccatgcc
ggccttcaggcggccgagtttctcgccaaggcaggcgccaaggtcgagatcatgacgccg
gaccggtccttcgcgcccgaggtcatggccatgaacctggtgccctatatgcggtctctg
cagaagcatgacgtgaccttcaccgtcacctaccgtctcgaagccgtcgagaagagcggc
aaccagctcgtcgcccatatcggcagcgattacggtgggatcgccaggcagcacagcttc
gaccagatcgtcgtcaatcatgggaccattccgctcgatgatctctatttcgagctgaag
cccagctcgagcaatctcggcgagatgtcgcacgaccagcttctttccggagaaccccag
tccgtcattcgcaatcctgatggcaagttccagctgttccggatcggggatgccgtcgcc
gcacgcaacacgcatgccgccgtctatgacggactgcgcatcgcgaaagatatctga

DBGET integrated database retrieval system