KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120520Help
Entry
pRL120520         CDS       T00402                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMSP_lyase Cupin_7
Motif
Other DBs
NCBI-ProteinID: CAK12229
GeneDB: pRL120520
RhizoBase: pRL120520
UniProt: Q1M3U5
Position
pRL12:565934..566539
Genome map
AA seq 201 aa AA seqDB search
MSLRNESLQIFLDAAFVAFDQFAKAPEARRSVRQMFAALERPGAARAGEGSRLPVCAQLD
VALSIDTSYPSLTQLIEGFKGIEPMLEWRRRTKYDHTASDNFVDGHANAMIIGPGGLEER
SDLWIGVTLMAPQVRYPDHVHAPEEVYLVLSEGEFQQGEGDWFSPGIGGSFYNVPDIKHA
MRSLDTPLFAFWALLAERPAV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagtttacgcaatgaaagcctgcagattttcctggatgcggctttcgtggctttcgac
cagttcgccaaagccccggaagcccgccgctcggtccgtcagatgtttgcggcgctggag
cgcccgggggctgcgcgggcgggagagggaagccgattgcccgtgtgcgctcagcttgat
gtagcgctctcgatcgatacgtcctatccttcgctgacgcaattgatcgaggggttcaaa
ggcatcgagccaatgcttgaatggcgccggcgcaccaagtatgaccacacggccagcgac
aattttgtcgatgggcatgctaatgcgatgatcatcggcccgggaggattggaggaacgg
agcgacctgtggatcggcgtgacgttgatggcgcctcaggtgcgctatcccgaccacgtt
catgcgccagaggaggtctacctcgtactgtccgagggagagttccagcagggggaaggg
gactggttttcgcccggcatcggcggatccttctacaatgtccccgacatcaagcatgcc
atgaggtcgctcgacacgccgctcttcgccttctgggcattacttgccgaacggccagca
gtttag

DBGET integrated database retrieval system