KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120524Help
Entry
pRL120524         CDS       T00402                                 

Gene name
adhI
Definition
(GenBank) putative alcohol dehydrogenase class III
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00010  Glycolysis / Gluconeogenesis
rle00071  Fatty acid degradation
rle00350  Tyrosine metabolism
rle00625  Chloroalkane and chloroalkene degradation
rle00626  Naphthalene degradation
rle00680  Methane metabolism
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01120  Microbial metabolism in diverse environments
rle01130  Biosynthesis of antibiotics
rle01200  Carbon metabolism
rle01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pRL120524 (adhI)
  09102 Energy metabolism
   00680 Methane metabolism
    pRL120524 (adhI)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    pRL120524 (adhI)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    pRL120524 (adhI)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pRL120524 (adhI)
   00626 Naphthalene degradation
    pRL120524 (adhI)
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pRL120524 (adhI)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     pRL120524 (adhI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: CAK12233
GeneDB: pRL120524
RhizoBase: pRL120524
UniProt: Q1M3U1
Position
pRL12:569136..570263
Genome map
AA seq 375 aa AA seqDB search
MDVRAAVAVQAGKPLEVMTVQLEGPKAGEVLVEVKATGICHTDDFTLSGADPEGLFPAIL
GHEGAGIVVDVGPGVTSVKKGDHVIPLYTPECRECYSCTSRKTNLCTSIRSTQGQGVMPD
GTSRFSIGKDKIHHYMGCSTFSNFTVLPEIALAKVNPDAPFDKICYIGCGVTTGIGAVIN
TAKVEIGATAIVFGLGGIGLNVLQGLRLAGADMIIGVDINPDRKAWGEKFGMTHFVNPKE
VGDDIVPYLVNLTKRHGDLIGGADYTFDCTGNTKVMRQALEASHRGWGKSIIIGVAGAGQ
EISTRPFQLVTGRNWMGTAFGGARGRTDVPKIVDWYMQGKIQIDPMITHTMPLEDINKGF
ELMHKGESIRGVVVY
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggacgttcgcgccgccgttgccgttcaggcaggaaaaccgctcgaagtgatgaccgtg
cagctggaaggcccgaaggccggcgaagtgctggtggaggtcaaggcgacgggcatctgc
cacaccgatgatttcaccttgtcgggcgccgatccggaaggcctcttcccggccattctc
ggccatgaaggcgccggcatcgtcgtcgatgtcggccccggcgtcacctcggtgaagaag
ggcgaccacgtcattccgctctacaccccggaatgccgcgaatgctattcctgcacctcg
cgcaagaccaatctctgcacctcgattcgatcaacccagggccagggcgtgatgccggac
ggcacctcgcgcttctcgatcggcaaggacaagatccaccactatatgggctgctcgacc
ttttcgaacttcaccgtgctgccggagatcgcccttgccaaggtcaatcccgacgctccg
ttcgacaagatttgctacatcggctgcggtgtgaccactggcatcggcgccgtcatcaac
accgccaaggtggagatcggcgccacggcgatcgtcttcgggcttggcggtatcggcctc
aacgtgcttcagggcctgcgtcttgccggtgccgacatgatcatcggcgtcgacatcaac
cctgatcgcaaggcctggggcgaaaagttcggcatgacccacttcgtcaatccgaaggag
gtcggcgacgacatcgtgccctatctcgtcaacctgacgaagcgccacggcgatctgatc
ggcggcgccgactacaccttcgactgcaccggcaacaccaaggtgatgcgtcaggcgctg
gaagcatcgcaccgcggctggggcaagtcgattatcatcggcgttgccggcgccggccag
gaaatctccacccgtccgttccagctggtcaccggccgcaactggatgggcaccgccttc
ggcggcgcgcgcggccgcaccgacgtgccgaagatcgtcgactggtacatgcagggcaag
atccagatcgatccgatgatcacccacacaatgccgctcgaagacatcaacaagggcttc
gagctgatgcacaagggcgaaagcatccgcggcgtggtcgtgtactga

DBGET integrated database retrieval system