KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120683Help
Entry
pRL120683         CDS       T00402                                 

Gene name
mcpB
Definition
(GenBank) probable MCP type chemoreceptor.
  KO
K03406  methyl-accepting chemotaxis protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02020  Two-component system
rle02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    pRL120683 (mcpB)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    pRL120683 (mcpB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:rle02035]
    pRL120683 (mcpB)
Bacterial motility proteins [BR:rle02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    pRL120683 (mcpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal HAMP
Motif
Other DBs
NCBI-ProteinID: CAK12392
GeneDB: pRL120683
RhizoBase: pRL120683
UniProt: Q1M3D3
Position
pRL12:734189..736336
Genome map
AA seq 715 aa AA seqDB search
MMLHFWNKFGIRAQITSGFVPLILLMSLLTVSAISGMNGLASIFSSYRATAGQSLAISDY
SDQLNEIQMSAEAFRSTPTQAVVDRFRAGVKAFDADDPRFAGNKDLQSGLAAIRQDIATY
GKAFEEIVALQARRDALISKVTEFGPWTSIALNDVVRSAWRQNDVPLLQMTAATLEALNR
SLYFSERFVHSDDFAAYDTAQAALAEAVTLNEAAAKAAKNELQKKRLMGAGQLMQNYTAR
LGDMKDVLQASGNIRQTQLSVLAPKISGGFKDLQATVTGAQKTLDGSVDATVASATSTTL
IISGLLIVIGLVLSYFVGRLISSAVRNMAQSMEQLARGEERIVITGVEHRHELGAMARSL
KVFQETGRAKLIAEANAERARLAAEEERLRQEAERLSDAQVMEHAFRQISVGLDALSKGD
LTVRVGEVDHRYVRIRDHFNNSVASLEEAVDAVIRAVGTIRSGLAEISTASNDLARRTEQ
QAASLEETVAALGEVTRGVNGTAEGASRAQGVVATARTNAEKGGEIVARAIDAMTEIQNS
SSKIGNIISVIDEIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSANAAREI
KQLISTSSAQVKTGVQLVGESGLSLEQIVEQVTAMNATVAEIAVAAREQATSLREVSAAG
DQMDKVTQQNAAMVEETTAAAQSLTHETESLAELLRRFRTGSGRVSEHRHYAMAS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgcatttctggaataaattcggcattcgcgcacagatcacctccggctttgtg
ccgctgatcctgttgatgagcctgctcacggtcagcgcgatctcgggtatgaacgggctc
gcctcgatcttctcgtcctatcgcgccacggccggccaaagtctcgccatctcggactac
agcgaccagctgaacgagattcagatgtcggcggaagccttccgctccacgccgacgcag
gctgtcgtcgaccgcttccgcgccggcgtgaaggcgttcgacgccgatgacccgcgcttt
gctggcaacaaggacctgcagtccggtcttgcggcgatccgccaggacatcgccacctat
ggcaaggctttcgaagaaatagttgccctgcaggccaggcgtgatgccttgatctccaag
gtcaccgaattcggcccctggaccagtattgcgctcaacgacgtcgtgcgcagcgcctgg
cgccagaacgatgtgccgctgctgcagatgacggcggcgacactggaggccttgaaccgc
agcctctatttctccgaacgcttcgtgcattccgatgattttgccgcctacgacacggcg
caggcagcactggccgaagcggtcacgctcaacgaagccgccgccaaggccgcgaagaac
gagctgcaaaagaagcgcctgatgggcgccggacagctgatgcagaactacaccgcccgt
ctcggcgacatgaaggacgtgctgcaggcctcgggcaacatccgccagacgcagctcagc
gtgctcgcgccgaaaatctcaggcggcttcaaggatctgcaggcgactgttaccggtgcg
cagaagacccttgatggttcggtggacgcaacggttgcctccgcgaccagcacgacgctg
atcatcagcgggctgctgatcgtcattggcctcgtcctttcctacttcgtcggccggttg
atttcctcggcggtgcgcaacatggcccagtccatggagcagcttgcccgtggtgaggaa
agaatcgtgataacgggcgtcgaacatcgccacgagctgggggccatggcgcgttcgctg
aaggttttccaggaaacggggcgcgccaagctgatcgcggaagccaatgccgaacgcgcc
cgcctggcggccgaagaagagcggctccgccaggaggccgagcggctcagcgacgcgcag
gtgatggagcatgccttccgccagatctcagtcgggctggacgcgctctcgaagggcgac
ctcacggtccgcgtcggcgaagtcgaccatcgctatgtcaggatccgggatcatttcaac
aactcggtcgcgagcctcgaggaggcggtcgacgccgtcattcgcgcggtcggcaccatc
cgctccggccttgcggaaatctccaccgcgtccaacgatctcgcccgccgcaccgagcag
caggcagcctcgctggaggagaccgtcgcggcgctgggtgaagtgacccgcggcgtcaat
ggaacggcggagggcgcaagccgcgcccagggagtcgtggcgaccgcccgcaccaatgcg
gaaaagggcggcgagatcgttgcccgcgccatcgatgcgatgacggaaattcaaaattcg
tcgtccaagatcggcaacatcatcagcgtcatcgacgagattgccttccagaccaacctg
ctggcgctgaacgccggcgtggaagcggcgcgcgccggcgaggcaggcaagggctttgcc
gtcgtcgcccaggaagtccgtgaactcgcccagcgctcagccaatgcggcaagggagatc
aagcagctgatctctacctcctcggcgcaggtcaagaccggcgtccagctggtgggcgaa
tccggcctctcgctcgaacagattgtcgagcaggtcaccgccatgaatgcgaccgtggcc
gagatcgctgttgccgcccgcgagcaggcgacaagcctgcgcgaggtctcggctgccggc
gaccagatggacaaggtgacgcagcagaacgccgcgatggtcgaggagaccacggcggcc
gcccagagcctgacacatgaaaccgaaagccttgccgaattgctgcggcggttcagaacg
ggcagcggccgggtatcggaacatcgccattacgcgatggcatcctga

DBGET integrated database retrieval system