KEGG   Rhizobium johnstonii: pRL70153
Entry
pRL70153          CDS       T00402                                 
Name
(GenBank) hypothetical protein
Organism
rle  Rhizobium johnstonii
SSDB
Motif
Pfam: T4SS
Other DBs
NCBI-ProteinID: CAK11680
RhizoBase: pRL70153
UniProt: Q1M9N7
Position
pRL7:126204..127013
AA seq 269 aa
MGMKRHLRASSLAISILLFQPGGSAVVAHAQDAVTPLPEPAVGGVPGAPPGVQETHDQVS
IEQIMKLVQLYRIMGGGITQMFTAVQNQKTALDVIRNGQTGPKTIPLMNGPDEVAARQGG
EGLKEMADSALNGAADGPPDLLAAFTHFRSTFSLDKAFALKDDELPSKKVLAQLAAKGAI
AGSVAESSYKRANASMERVDDYIAAVQASKDLKTSIDINTRAVIELTQQTNESLRTQSAV
TSIVSSYFMMLASEASTEDWIDGLKDFNR
NT seq 810 nt   +upstreamnt  +downstreamnt
atgggtatgaaacggcatcttcgagccagctcactggctatttcgatccttctttttcaa
ccgggtgggtctgccgtggtcgcccatgcgcaggacgccgtcactccactgccggaacct
gccgtcgggggtgtgccgggcgcccctcccggtgtccaggagacccatgaccaggtttca
atcgagcaaatcatgaagctcgtccagttgtatcgcatcatgggcgggggcattactcag
atgttcacggcagtccagaaccagaagacggctcttgatgttattcgtaacgggcagact
ggaccaaagaccattccgcttatgaacggaccggacgaagtcgctgcccgccagggcggc
gaaggcctcaaggaaatggcagacagcgccttgaatggcgccgccgatggtccaccggat
ctcctggcagcattcacccatttccgtagcaccttctctctcgacaaagcattcgcgctc
aaggatgacgagctacccagcaaaaaggtgctcgctcagctcgccgccaagggcgcgatc
gccggctccgtagcggaaagctcctacaagcgtgccaacgcgagcatggagcgggtagac
gactacatcgcggccgttcaggcgagcaaggatttgaagacgagcatcgacatcaacacg
cgcgcggtgatcgagctcacgcagcaaaccaatgaaagcctaagaacgcagtcggccgtc
acctccattgtcagcagctatttcatgatgttggcaagcgaagcgagcacggaagattgg
attgacggccttaaggacttcaataggtga

DBGET integrated database retrieval system