KEGG   Rhizobium johnstonii: pRL70156
Entry
pRL70156          CDS       T00402                                 
Symbol
trbGp7
Name
(GenBank) putative conjugative DNA transfer protein
  KO
K03204  type IV secretion system protein VirB9
Organism
rle  Rhizobium johnstonii
Pathway
rle03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rle00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    pRL70156 (trbGp7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rle02044]
    pRL70156 (trbGp7)
Secretion system [BR:rle02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   pRL70156 (trbGp7)
SSDB
Motif
Pfam: CagX
Other DBs
NCBI-ProteinID: CAK11683
RhizoBase: pRL70156
UniProt: Q1M9N4
Position
pRL7:129154..129936
AA seq 260 aa
MFKHTAVLLLLSAGAPLADQAPISATESVSALRQKPAAAAPASDPRIRRFAYNENKVYRL
DLYLKSVTALQLSQSEEVESILIGDSASWEVVKLKAGNVVSIKPTLPSATTNMTIYTNRR
VYTFELRSMGEFTGGANAAPLFRSIFTYADEEKPKQNSDASLRPDHLRADYLFSGEAAFR
PRWVQDDGRQTMFFLPEGAPRPAVFKVGPGNKEQLINSRTNANQIIVDGTSDYWIMRIGN
ESVCIGRTGPTRLNRNVTVR
NT seq 783 nt   +upstreamnt  +downstreamnt
atgttcaagcacaccgcagttctgctacttctgagtgcgggcgcgcccctcgccgatcaa
gcgcccatctccgcgaccgaatccgtctccgcactacgacaaaaacccgcggcggcagca
ccggccagcgatccgcgcattcggcgtttcgcctacaatgaaaacaaagtctatcggctc
gacctttatctcaaatcggttacagcgctgcagctttcgcagagcgaggaagtcgagtct
atccttatcggcgacagtgcatcctgggaagtggttaagctcaaggccggaaacgtcgtc
agcatcaaaccgacgcttccctcggccacgaccaacatgaccatctataccaacagacgg
gtctatacatttgagcttcgttccatgggtgaattcacgggcggtgctaatgctgcaccc
ctcttccgttcgatcttcacctatgcagacgaagagaagccgaagcagaatagcgacgcc
tccttgagaccggaccaccttcgcgcggactacctgttctcgggtgaggccgcatttcga
ccacgctgggtccaagacgacggccggcagacgatgttcttcctgcctgaaggcgctcct
cgcccggccgtttttaaggtgggaccgggcaacaaggaacagttgatcaactcccgcacc
aatgcaaaccagatcatcgttgatggaacgagcgattactggatcatgcgtataggcaac
gagtccgtgtgcatcggtcgtaccggccccacgcggctcaacagaaacgtcacggttaga
tga

DBGET integrated database retrieval system