KEGG   Rhizobium johnstonii: pRL70157
Entry
pRL70157          CDS       T00402                                 
Symbol
trbLp7
Name
(GenBank) putative conjugative DNA transfer protein
  KO
K03195  type IV secretion system protein VirB10
Organism
rle  Rhizobium johnstonii
Pathway
rle03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rle00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    pRL70157 (trbLp7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rle02044]
    pRL70157 (trbLp7)
Secretion system [BR:rle02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   pRL70157 (trbLp7)
SSDB
Motif
Pfam: TrbI Saf4_Yju2 DUF2937
Other DBs
NCBI-ProteinID: CAK11684
RhizoBase: pRL70157
UniProt: Q1M9N3
Position
pRL7:129947..131320
AA seq 457 aa
MSENDHRIGPIRDDGIESTDSEHSARERSGLVNARRARQTRGTSGATNARLIMSAGLMGG
AVVLFFAVAGPTAALKVLGIGRDNDQAVSKVDMEVEKDSHRPVHLDFAVPASTEPEKKEL
DPNAAWKAKIKALQDQIAELERKKQGSVSSGEIEALITRYNENTKRQFEDERKAMTEENA
RLRAAAERAEEERQRAEEAGKLQSGELKERQKLDKMQRESGSVVVDAADGPATTESDKSA
TDQNQNARFLKTAASSTYPTSVSRPLPDPSRTVVQGTIISAVLETAIDTELPGNIRAQVM
EPVYSFDGARVLMPSGTILIGEFNNDVNLAQRRVLIAWNRAITPSGQSIALGSTGADTLG
RSGTEGNVNNRYGTKFGAAILISAITSLPSILSNRNSQSKSGTTSKVGGGQDAGQMSDTA
SDQARGVLDQYLSLPPAIKIPQGEEIRVLVNRDLVFR
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgtcggaaaacgatcaccgcattggccctattcgcgatgatggcatcgagtcgacggac
tctgaacacagtgcaagggaacgcagcgggctcgtcaacgctcgccgcgcacgacagaca
cgtggtacgagcggcgcaactaatgcaaggctcataatgtcggcgggcttgatgggaggg
gccgtggtattgttcttcgcggtcgctgggccgacggctgccctaaaggtcctggggatc
ggccgcgacaacgaccaggcggtttctaaggtcgatatggaagttgagaaagattctcat
cgaccagttcatctcgatttcgccgtacctgcgagcacggaacctgaaaagaaggagtta
gatcctaacgcggcctggaaagcaaagatcaaggcgctacaggatcagattgctgaactc
gagcgcaagaagcaaggcagcgtctcctctggagaaattgaggcgctgattacccgctac
aacgagaatacgaagcggcagtttgaagatgagcgcaaggcaatgaccgaagaaaacgcc
cggttgagagccgctgccgagcgagcggaagaggagcgccagcgtgccgaagaggcggga
aagctgcagtcgggcgagctcaaggagcgccagaaactcgacaagatgcagcgtgaatcc
ggctcggtggttgtcgacgcggctgatggacctgcgaccactgagagcgataaatcggcg
actgaccagaaccaaaacgcgcggttcctaaagacggctgccagcagcacgtacccgacg
tctgtttcgcggccgctgcctgatccctcgcgcacagtggtgcaaggaaccattatctca
gccgtgctcgaaactgcgatcgatacggagctgcctggcaatattcgtgcacaggtgatg
gaacctgtttattcatttgatggagcgcgcgttctgatgccctctggaaccattttgatc
ggtgagttcaataacgacgtcaacctcgctcagaggcgcgtcctgattgcatggaaccga
gcgattacgccttcgggacaatcgatcgcgcttggttccaccggcgcggacacacttggg
cggtcgggcacggaaggtaatgtgaacaaccgttatggcacgaaattcggggccgccatc
ctcatcagcgccatcacctcccttccttcgatactgtccaaccgcaacagccagtctaaa
tccggcacgacctccaaggtcggcggcggccaggacgcgggacagatgagcgacacggcg
agcgaccaggcaaggggcgtccttgatcagtatctttcgctaccgccggccattaaaatt
ccgcaaggtgaggagatccgggttctcgtaaatcgagatcttgtattcagatga

DBGET integrated database retrieval system