KEGG   Rhizobium johnstonii: pRL80123
Entry
pRL80123          CDS       T00402                                 
Symbol
traFp8
Name
(GenBank) putative conjugal transfer protein TraF
Organism
rle  Rhizobium johnstonii
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: CAK02925
RhizoBase: pRL80123
UniProt: Q1M996
Position
pRL8:130129..130695
AA seq 188 aa
MMSHISPTSAVVRQKRPVLALLAVSCGIALVVIIGGFIGGLRINTTPSEPLGLWRVAPLE
HPIQVGEMVFVCPPETDAVSEGFERGYLRSGLCPGGFGPLIKTVAAVGGKRIEIAGNVTI
DGRPIANSSLVSQDGQGRPLRPYAGGTIPAGFLFLHSPFPGSWDSRYFGPVPGSGVLGLA
EQVLTYAP
NT seq 567 nt   +upstreamnt  +downstreamnt
atgatgtctcatatctcccccacctctgccgttgtgcgccaaaagcgcccggttctcgcc
ctcctcgcagtgtcatgtggcattgcgctcgtggtgattatcggcgggttcatcggcggc
ctgcggatcaacaccacgcccagcgagccactcgggctctggcgtgtcgcacccctcgaa
cacccgattcaggtgggtgaaatggtgttcgtctgcccgccggagactgacgccgtttcg
gagggatttgagagaggctaccttcgctcaggcctgtgccccggcggctttggccccctc
atcaaaacggtggctgcggtcggcgggaagcgcatcgagatcgccggcaatgtcacgatc
gatggacggccgatcgcaaactcgagcctcgtgtctcaggacggccaggggcggccattg
cgcccgtacgcaggagggacgattccggccggcttcctgttcctccattcgccatttccc
ggatcctgggactctcgatatttcgggccggtcccaggatccggtgttctcggcctcgca
gaacaggtgcttacctatgcgccctga

DBGET integrated database retrieval system