KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL80140
Entry
pRL80140          CDS       T00402                                 
Symbol
trbDp8
Name
(GenBank) putative conjugal transfer protein TrbD
  KO
K20529  type IV secretion system protein TrbD
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rle00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    pRL80140 (trbDp8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rle02044]
    pRL80140 (trbDp8)
Secretion system [BR:rle02044]
 Type IV secretion system
  Trb secretion system protein
   pRL80140 (trbDp8)
SSDB
Motif
Pfam: VirB3 Glucos_trans_II DUF6343 TMEM210
Other DBs
NCBI-ProteinID: CAK02940
RhizoBase: pRL80140
UniProt: Q1M981
Position
pRL8:complement(145456..145755)
AA seq 99 aa
MADAGVGLHRNRIHRALSRPNLLMGADRELVLLTGLAAIILIFVVLTIYSALFGIAIWIV
VVGALRMMAKADPMMRKVYARHMRYRAHYLPTSAPWRRY
NT seq 300 nt   +upstreamnt  +downstreamnt
atggctgacgccggcgtcggactccatcgcaaccgtattcaccgtgctctctcgcgaccg
aacctcttgatgggagcggatcgagaactcgtgctgctgaccgggctcgccgcgatcatc
ctcatcttcgtcgtcctgaccatctactcggcacttttcggcatcgcgatctggatcgtg
gtcgtcggcgcgctccgcatgatggcgaaggcggaccccatgatgcgcaaagtctatgca
cgccatatgcggtaccgggcgcactacctcccgacctccgcgccctggcgccggtactga

DBGET integrated database retrieval system