KEGG   Rhizobium johnstonii: pRL80141
Entry
pRL80141          CDS       T00402                                 
Symbol
trbCp8
Name
(GenBank) putative conjugal transfer protein TrbC
  KO
K20528  type IV secretion system protein TrbC
Organism
rle  Rhizobium johnstonii
Pathway
rle02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rle00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    pRL80141 (trbCp8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rle02044]
    pRL80141 (trbCp8)
Secretion system [BR:rle02044]
 Type IV secretion system
  Trb secretion system protein
   pRL80141 (trbCp8)
SSDB
Motif
Pfam: TrbC
Other DBs
NCBI-ProteinID: CAK02941
RhizoBase: pRL80141
UniProt: Q1M980
Position
pRL8:complement(145748..146140)
AA seq 130 aa
MQHNRFLRLGIIGALLCASLAGPALAGSGGSLPWEGPLEQIQQSITGPVAGYIALAAVAI
AGGMLIFGGELNDFARRLMYVVLVAGILLGATTIVGLFGSTGASIGSSFVAEQPPTPSST
PLGGGEGRHG
NT seq 393 nt   +upstreamnt  +downstreamnt
atgcagcataatcgctttctccgtttgggaattatcggcgcattgctttgcgcctcgctt
gccgggccagcacttgcaggttcaggcggaagcctgccgtgggaaggtccgctcgagcag
atccagcagtccatcacgggaccggtcgccggctatattgcactggccgccgtcgcgatt
gccggcggcatgctgatcttcggcggcgagctcaacgatttcgcgcggcgactgatgtat
gtggtactcgtcgcggggatcctgcttggtgccacaacaattgtcggcctcttcggttcg
accggtgcctcgatcggtagctcgtttgtcgccgagcaacccccaactccttcttcaact
ccgttagggggaggggaggggcgtcatggctga

DBGET integrated database retrieval system