KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL90166Help
Entry
pRL90166          CDS       T00402                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00310  Lysine degradation
rle01100  Metabolic pathways
rle01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    pRL90166
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     pRL90166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 NAD_binding_8 HI0933_like FAD_binding_2 FAD_binding_3 Lycopene_cycl FAD_oxidored Thi4
Motif
Other DBs
NCBI-ProteinID: CAK03883
GeneDB: pRL90166
RhizoBase: pRL90166
UniProt: Q1M904
Position
pRL9:183790..184995
Genome map
AA seq 401 aa AA seqDB search
MSVAMIHDVCIIGGGIVGLATAMAVLEKRPGASVVLLEKEPGLAVHQTGHNSGVIHAGIY
YAPGSLKARLCREGADAIKAFCGEKAVPYEQCGKLVVATNELEHRRLKDLAERAKINNID
IEWLDRNSLKHREPMVEGVAAIFVRATGIVDYKAVCVAMGAHLAAQGVEIELNTQVSAIR
ETLDLVEIAAGDRQWRARQLIACAGLQSDRIAKLAGLKIDHQIIPFRGEYFRPPPSRNGL
VRHLIYPVPDPSLPFLGMHVTKMIDGSLTVGPNAILGMAREGYPKFSINIRDLSECLSFP
GLWRLLWKNAGGAVNEFRDSLWRKNYLEACRKYCPSLTLEDLQPMEAGIRAQAVMRDGRL
EHDFLFLKTGRMLHVCNAPSPAATSSIPIGRDIADRCFSAG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcgcaatgattcacgacgtctgcatcataggcggcggtatagttggtcttgcc
accgccatggccgttctggaaaagcgccccggtgcaagtgtcgttctccttgaaaaggag
cctggcttggccgtccaccagacagggcacaacagcggcgtcatccacgcgggaatctac
tatgcgccaggcagcttgaaagcgcgcctttgtcgggagggggccgatgccatcaaggcg
ttctgcggggagaaggctgtaccctatgaacaatgcggaaaactggtggttgccaccaac
gagctcgaacaccgccgcctgaaggacctggccgaacgggcaaagatcaacaacatcgat
atcgaatggctcgatcggaattcgttgaaacatcgggagcccatggtcgaaggcgtcgcg
gcaattttcgttcgggcgacgggtatcgtcgactacaaggctgtgtgcgtcgccatgggc
gctcatctggccgctcagggcgtggaaatcgaattgaatacgcaggtttccgcgatccgc
gaaaccttggatctcgtggagattgcagcgggtgatcgccaatggcgggccagacagctc
atcgcctgcgccgggctgcagtccgaccgcatcgccaaacttgctggcctcaagatcgat
catcagatcataccgttcaggggcgaatatttccgtccgccgccgtcgcggaatggactg
gtcaggcacctgatctatccggtgcccgatccgtcgcttccattccttggcatgcatgtc
accaagatgatcgacggcagccttaccgtcggacctaatgcgattctgggaatggcccgc
gaggggtatccgaaattcagcataaacatccgggatctcagcgagtgtctctcgtttccg
ggcctatggcggcttctctggaagaacgcagggggcgccgtgaacgaattcagggactcg
ctgtggcggaaaaactatctggaagcgtgccgcaaatactgcccatcgctgacactcgaa
gaccttcagccgatggaagcgggcatccgggcccaggcggtcatgcgggacgggcgcctg
gagcatgatttcctgttcctaaaaacgggtcgcatgctgcacgtctgcaatgcgccgtcg
ccggcagccacatcgtcgatcccgatcggccgggatatcgccgacaggtgcttttccgcc
ggctga

DBGET integrated database retrieval system