KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_1507Help
Entry
Rleg_1507         CDS       T00926                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00360  Phenylalanine metabolism
rlg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rlg00790  Folate biosynthesis
rlg01100  Metabolic pathways
rlg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rlg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Rleg_1507
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rleg_1507
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rleg_1507
Enzymes [BR:rlg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Rleg_1507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ACS55798
UniProt: C6AVI7
Position
complement(1489620..1490411)
Genome map
AA seq 263 aa AA seqDB search
MTKESSYTAKLPGPDGLYDYTPDEDVIWGELYRRQMTLLSDTACREYLDGVKMLGLKPDK
VPQLLDVNRRLNETTGFGVEGVPALIPPSRFYELLSQGKFPLATFLRRREHIDYIEEPDL
FHEVFGHCPMLTNQSYANFVRHFGETAVRLGKGYSWHLFRIFWFTVEFGLINTPQGRRCF
GAGIVSSPNEAKAAMEGKACEFRPFDLLSVLRTPYRIDILQPIYYLIDSFADLEAIVEQD
IEATILKAKQLGDFAPAFEAKAS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggaaagcagctataccgccaaactgcccggcccggatggtttgtacgactac
accccggatgaagatgttatctggggcgaactctaccggcgtcagatgacgctgctttcc
gataccgcctgccgcgaatatctggacggcgtcaaaatgctggggctgaagccggataag
gtgcctcagcttctcgatgtgaacagacgcctgaacgagaccaccggctttggcgtcgaa
ggtgtgccggcgctcattccgccctcacgcttttatgaacttctgtcacaaggcaaattc
ccgcttgcaaccttcctgcgccgtcgcgaacatatcgattatatcgaggagccggacctg
ttccacgaggtcttcggccactgccccatgctcaccaaccagagctatgccaatttcgtc
cggcatttcggcgaaaccgcggtccgcctcggcaagggctattcatggcatctgttccgg
atcttctggttcactgtcgaattcggcctgatcaatacgccgcagggacgccgctgcttc
ggcgcgggcatcgtctcatcgcccaacgaagcgaaagcggcaatggaaggcaaagcgtgc
gaattccggccgttcgatctgctgagcgtgctgcggacgccctaccggatcgatatcctc
cagccgatctactatctgatcgacagcttcgccgatcttgaagcgatcgtggagcaggat
atcgaggccacgatcctcaaagcaaaacagctgggagatttcgccccggctttcgaagcc
aaagcttcgtga

DBGET integrated database retrieval system