KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_1717Help
Entry
Rleg_1717         CDS       T00926                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00970  Aminoacyl-tRNA biosynthesis
rlg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rleg_1717
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rlg03029]
    Rleg_1717
Enzymes [BR:rlg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Rleg_1717
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Rleg_1717
Mitochondrial biogenesis [BR:rlg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Rleg_1717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACS56003
UniProt: C6AWG5
Position
1712686..1714167
Genome map
AA seq 493 aa AA seqDB search
MSELTSLTIAEARQKLRAKEITAIELTEAYISAIDAANGRLNAYIKVTPDLARVMAKNSD
ERIAAGKAGELEGIPLGIKDLFATVGVHTQACSHILNGFEPRYESTVTQNLWDDGAVMLG
KLNMDEFAMGSSNETSHYGAVINPWRAAGSNQQLVPGGSSGGSAAAVAAHLCAGATATDT
GGSIRQPAAFTGTVGIKPTYGRCSRWGTVAFASSLDQAGPIARDVRDAAILLKSMASVDA
KDTTSVDLPVPDYEAALGQSLKGMKIGIPNEYRVDGMPDEIETLWRQGIAWLKDAGAEIV
DISLPHTKYALPAYYIVAPAEASSNLARYDGVRYGLRVDGKDIVDMYEKTRAAGFGKEVK
RRIMIGTYVLSAGYYDAYYIRAQKVRTLIKRDFELAFDAGVDAILTPATPSSAFGVADEN
LAADPVKMYLNDIFTVTVNMAGLPGIAVPAGLDHKGLPLGLQLIGKPFDEETLFKTAHVI
EQAAGRFTPAKWW
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactcaccagcctgaccattgccgaagcccgccagaagctgcgcgccaaggaa
atcaccgcgatcgaactgaccgaagcctatatctcggcgatcgatgcggccaatggccgg
cttaacgcctatatcaaggtcacgccggatctcgcccgcgtcatggcgaagaactccgac
gagcgcatcgccgccggcaaggcaggcgaactcgaaggcattccgctcggcatcaaggat
ctctttgccaccgtcggcgttcacacccaggcctgcagccacattctcaatggtttcgag
ccgcgttatgaatcgaccgtaacgcaaaacctctgggatgacggcgccgtcatgctcggc
aagctgaacatggatgagttcgccatgggctcctccaacgagacctcgcattacggcgcg
gtgatcaatccctggcgtgccgcaggctccaaccagcagctcgttccgggcggctcgtcg
ggcggttcggccgcagccgtcgcagcgcatctttgcgccggcgccacggcgacggatacc
ggcggctcgatccgccagccggccgccttcaccggcaccgtcggcatcaagccgacctat
ggccgctgctcgcgctggggcaccgtcgccttcgcttcttcgctcgaccaggcaggcccg
atcgcccgcgacgtgcgcgatgccgcgatccttttgaagtcgatggcaagcgtcgacgca
aaggacacgacatcggtcgatttgccggtgccggactacgaagcagccctcggccagtcg
ctgaagggcatgaagatcggcattccgaacgaataccgcgtcgacggcatgccggatgag
atcgaaaccctttggcgccagggcatcgcctggctgaaggatgccggcgccgagatcgtc
gacatctcgctgccgcacaccaaatacgcccttccggcctattatatcgttgctcccgcc
gaggcatcctcgaacctcgcgcgctacgacggcgtgcgctatggcctgcgcgtcgacggc
aaggatatcgtcgacatgtacgagaagacgcgtgccgcgggcttcggcaaggaggtcaag
cgccgcatcatgatcggcacctatgtgctgtcggctggttattacgatgcctattacatc
cgcgcccagaaggtgcgcacgctgatcaagcgcgatttcgaactcgccttcgacgccggc
gtcgatgccatcctgacaccggcaacgccgtcgtctgcctttggcgttgccgatgagaac
ctcgccgccgatccggtgaagatgtatctgaacgacatcttcacggtgacggtcaacatg
gcgggcctgcccggcattgccgtgccggccggcctcgatcacaaaggcctgccgctcggc
ctgcagctgatcggcaaaccctttgacgaggaaaccctcttcaagaccgctcatgtcatc
gagcaggcggccggccggtttacgccggccaagtggtggtaa

DBGET integrated database retrieval system