KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_1722Help
Entry
Rleg_1722         CDS       T00926                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00970  Aminoacyl-tRNA biosynthesis
rlg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rleg_1722
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rlg03029]
    Rleg_1722
Enzymes [BR:rlg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Rleg_1722
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Rleg_1722
Mitochondrial biogenesis [BR:rlg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Rleg_1722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N
Motif
Other DBs
NCBI-ProteinID: ACS56008
UniProt: C6AWH0
Position
1716119..1717621
Genome map
AA seq 500 aa AA seqDB search
MTLVDVRTPDPKRFIPGATGDWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSLVD
AAMPGMLPVINEECVRQAVRTGLGLKAQINKRSLFDRKNYFYPDLPQGYQISQFKDPIVG
EGKIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSMHDQHATMSYVDLNRSGVALMEIVS
KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEDFGTRCEIKNV
NSIRFIGQAIEYEARRQIGILEEGGKIDQETRLFDPGKGETRSMRSKEDAHDYRYFPDPD
LLPLEFDDAFIKALEVHLPELPDDKKERFVRELGLSIYDASVLVSEKAIADYYEAVAAGR
DGKMAANWVINDLLGALNRTGKDIEQTPVSPAQLGAIIDLIKAETISGKIAKDLFEIVLT
EGGDPAEIVEARGMKQVTDTGAIEKAVDEIIAANPDQVEKVKTKPTMAAWFVGQVMKATG
GKANPQAVQALVKAKLGIEE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgtcgacgtccgcacgcctgatccgaaacgcttcatccccggcgccaccggc
gactgggaggtcatcgttggcatggaagtccatgcccaggtgctgtccaattcgaagctc
ttctccggcgcctcgacggaattcggcaagccgcagaattcgaacgtctcgctggtcgac
gccgccatgcccggcatgctgcccgtcatcaacgaggagtgcgtcaggcaggccgtgcgc
accggcctcggcctgaaagcccaaatcaacaagcgctcgctctttgatcgcaagaactat
ttctatcccgacctgccgcagggctatcagatctcgcagttcaaggatccgatcgtcggc
gagggcaagatcgtcatttcactcggacctgaccgccagggccagttcgaagatatcgag
atcggcatcgaacgcctgcatctggagcaggatgccggcaagtcgatgcacgaccagcac
gcgaccatgtcctatgtcgatctgaaccgttccggcgtcgcgctgatggagatcgtctcg
aagcccgacatgcgctcgtccgacgaggccaaggcctatatgaccaagctgcgttcgatc
gtgcgttacctcggtacctgcgacggcaacatggacgaaggctcgatgcgcgccgacgtc
aacgtctccgtccgccggccgggcgaggatttcggcacgcgttgcgagatcaagaacgtc
aactccatccgcttcatcggtcaggcgatcgaatatgaagcccgtcgccagatcggcatt
ctggaagaaggcggcaagatcgatcaggagacccgcctcttcgacccgggcaagggcgag
acgcgttcgatgcgctccaaggaggatgcgcacgactatcgttatttccccgatccggat
ctgctgccgctcgaattcgacgatgccttcatcaaggcgctcgaagtgcatctgccggag
ctgcccgacgacaagaaagagcgcttcgtgcgcgaactcggcctgtcgatctacgacgcc
tcggtgctcgtttccgaaaaggcgatcgccgattattacgaagccgtcgccgcaggccgt
gatggcaagatggccgccaactgggtgatcaacgatctgctcggcgcgctgaaccgcacc
ggcaaggacatcgagcagaccccggtttcgccggcccagctcggcgccatcatcgacctc
atcaaggccgaaaccatctccggcaagatcgccaaggatctcttcgagatcgttctgact
gaaggcggcgatccggccgagatcgtcgaagcgcgaggcatgaagcaggtgacggatacc
ggcgcgattgaaaaggccgttgacgagatcatcgccgccaatcctgaccaggtcgaaaag
gtcaagacgaagccgaccatggcggcctggttcgtcggccaggtgatgaaggcgaccggc
ggcaaggccaatccacaggctgtccaagcccttgtcaaggcaaagctcggcatcgaggaa
taa

DBGET integrated database retrieval system