KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_2199Help
Entry
Rleg_2199         CDS       T00926                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00010  Glycolysis / Gluconeogenesis
rlg00260  Glycine, serine and threonine metabolism
rlg00680  Methane metabolism
rlg01100  Metabolic pathways
rlg01110  Biosynthesis of secondary metabolites
rlg01120  Microbial metabolism in diverse environments
rlg01130  Biosynthesis of antibiotics
rlg01200  Carbon metabolism
rlg01230  Biosynthesis of amino acids
Module
rlg_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg_2199
  Energy metabolism
   00680 Methane metabolism
    Rleg_2199
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rleg_2199
Enzymes [BR:rlg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rleg_2199
Membrane trafficking [BR:rlg04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Rleg_2199
Exosome [BR:rlg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rleg_2199
  Exosomal proteins of melanoma cells
   Rleg_2199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACS56476
UniProt: C6AZS2
Position
2198998..2199747
Genome map
AA seq 249 aa AA seqDB search
MRLFLVRHGESLGNINEQAYRQFGDHNVPLTRWGHRQALEAGGVIASYLQALPSAGFGKL
HIWYSPFLRTRQSKDALLEALPESFVGDIREDYLLREQDFGLFTEIYDHAEQKQKFPEEF
EKWARLRSNSGKFYARPPDGESRADVAQRVRLFLQTVMHDAENSDHNVVIVGHGVTNRAV
EMNFLHRPVEWFERSDNPGNADITLIEGTRSQGYESILLHQAADRQPGQEGELRDAHGAD
VTITPKPTA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctctttctcgttcgccacggcgaatccctcggcaacatcaacgaacaggcctac
cgtcaattcggcgatcacaatgtgccgctgacgcgatggggccatcggcaggctctcgaa
gcaggcggcgtgatcgcctcctacctgcaagcattgccgagcgctggtttcggcaagctg
catatctggtactcgccctttctgaggacccggcagagcaaggatgcgctgctcgaagcc
ctgccggaaagtttcgtcggcgatatcagggaggattatctgctgcgcgagcaggatttc
ggtctcttcaccgaaatctacgatcacgcggaacagaagcagaagtttcccgaggagttc
gaaaaatgggcgaggctgcgcagcaacagcggcaagttctacgcacggccgccggatggc
gaaagccgggcggatgtggcccagcgggtgcgcctgttcctgcaaaccgtcatgcacgat
gcagaaaatagcgaccacaacgtcgtgatcgtcggccatggcgtcaccaaccgggcggtc
gaaatgaatttcctgcaccgccccgtcgagtggttcgagcgctccgacaatcctggaaac
gccgatatcaccctgatcgaggggacgcgctcgcaaggatacgagtcgatcttgttgcat
caggccgccgaccggcagccgggacaggaaggcgaactgcgcgatgcccatggcgccgac
gtgacgatcacgccgaagccgactgcataa

DBGET integrated database retrieval system