KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_2801Help
Entry
Rleg_2801         CDS       T00926                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00670  One carbon pool by folate
rlg00790  Folate biosynthesis
rlg01100  Metabolic pathways
Module
rlg_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rleg_2801
   00670 One carbon pool by folate
    Rleg_2801
Enzymes [BR:rlg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Rleg_2801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ACS57062
UniProt: C6ARN7
Position
complement(2782875..2783393)
Genome map
AA seq 172 aa AA seqDB search
MADIRRTIIAAVARNGIIGRDGDMPWRLSSDLKRFKALTLGKPVVMGRKTYESIGKPLPG
RPNVVISRQAAIEHPDVSMTHSLSEAITAAERLALETGVDEICILGGGQVYAQAIGLADR
MCITHVEADLDGDASFPVIDPDIWQAGEAIAVPAGEKDSYPTRFVVYERRRA
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatccgcaggaccattatcgccgccgttgcccgcaacggcattatcggccgt
gacggcgacatgccgtggcggctttcgagcgatctcaagcgcttcaaggcgctgacattg
ggaaagcctgtggtgatgggccgcaagacctacgagtcgatcggcaagccactgccggga
cggccgaacgtcgtcatttcgcggcaggcagcgatagaacatcctgatgtctccatgacg
cattcgctgtccgaggcgataacggcggccgaaaggctggcgctcgaaaccggcgtcgac
gagatctgcattctgggcggcgggcaggtctatgcccaggcgatcggtcttgccgaccgg
atgtgcatcacgcatgtcgaggccgatctcgacggagacgcgtcgtttcccgtgattgat
cccgatatctggcaggcaggggaggcgatcgcggttccggccggcgagaaggacagctat
cccacgcgcttcgtcgtctacgaacgccgacgcgcctga

DBGET integrated database retrieval system