KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_3515Help
Entry
Rleg_3515         CDS       T00926                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rleg_3515
Enzymes [BR:rlg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Rleg_3515
DNA repair and recombination proteins [BR:rlg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Rleg_3515
    RecFOR pathway proteins
     Rleg_3515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_2 DUF1421
Motif
Other DBs
NCBI-ProteinID: ACS57761
UniProt: C6AVT9
Position
3549525..3550139
Genome map
AA seq 204 aa AA seqDB search
MIGKLKGTIDEIGEDYVLVDVHGVCYVAHCSARTLSKLGSAGEACVLFIETYVREDQLKL
FGFMTALEREWFNLLQSVQGVGAKVALAVLSTLTPGELANAIALQDRTAVSRAPGVGPKV
AMRLVTELKNRAPAFAGEAINIALKQELGEGVAAAPVADAVSALTNLGYSRDQAANAVAA
AMKTAGDNADSAKLIRLGLKELAR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctgaaaggcaccatagacgagatcggcgaagactatgtgctcgtcgat
gtgcacggcgtctgctacgtcgcccattgctcggcccgcaccctgtcgaagcttggctcg
gctggcgaggcctgcgtgctgttcatcgagacctatgtgcgcgaggatcagttgaagctc
tttggcttcatgaccgcgctagagcgggaatggttcaacctgctccaaagcgtccagggc
gtcggcgccaaggtggcgctcgccgtgctctcgacgttgaccccaggcgaactggctaat
gcgatcgccctgcaggaccgcactgccgtctcccgcgcgccgggcgtcggtccgaaagtg
gcgatgcgcctcgtcaccgagctcaagaaccgggcgcctgcctttgccggggaagcaatc
aatatcgctctcaagcaggaactcggtgaaggcgtcgcggcagcaccggtcgccgatgcg
gtgtccgcattgaccaacctcggctattcccgcgaccaggccgccaatgcggttgccgcg
gcaatgaagacggcgggtgataacgccgacagcgccaagctgatcaggctgggattgaag
gaactggcgcggtga

DBGET integrated database retrieval system