KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4199Help
Entry
Rleg_4199         CDS       T00926                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00330  Arginine and proline metabolism
rlg00332  Carbapenem biosynthesis
rlg01100  Metabolic pathways
rlg01130  Biosynthesis of antibiotics
rlg01230  Biosynthesis of amino acids
Module
rlg_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rleg_4199
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Rleg_4199
Enzymes [BR:rlg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Rleg_4199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA TruB_C
Motif
Other DBs
NCBI-ProteinID: ACS58440
UniProt: C6B032
Position
4293475..4294644
Genome map
AA seq 389 aa AA seqDB search
MTSRKPLGRYRRIVIKIGSALLVDRKAGLKKAWLDAMCADISGLKAKGIDVLVVSSGAIA
LGRSVLDLPSGALKLEESQAAAAVGQIALARAWSESLSRDEIVAGQILLTLGDTEERRRY
LNARATINQLLKIGAVPIINENDTVATSEIRYGDNDRLAARVATMTGADLLILLSDIDGL
YTAPPHLDPNATFLETIAEITPEIEAMAGGAASELSRGGMRTKIDAGKIATASGCAMIIA
SGKTDNPLSAIENGARSSWFAPSGTPVTARKTWIAGQLQPAGELHVDDGAVTALGAGKSL
LPAGVRSVSGLFSRGDTVAVIGPAGREIARGLVSYDADDARRIAGRKSAEIEAILGYAGR
AAMVHRDDMVMTAQIGSKSERQKKDASYA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccagccgtaagccgcttggccgctaccgccgcatcgtcatcaagatcggatctgcg
cttctggtcgaccgcaaggccgggctgaagaaggcctggctcgacgccatgtgcgccgat
atctcaggcctgaaggctaaaggcatcgatgtgctcgtcgtctcctcgggggcaatcgcg
ctcggccgctcggtgctcgacctgccctcgggcgcgctgaagctggaggaaagccaggcg
gccgccgccgtcggccagatcgcgctggctcgtgcctggtcggagagcctgtcacgcgac
gagatcgtcgccggtcagatcctgctgacgctcggcgataccgaggagcgccgccgctat
ctcaatgcgcgcgccaccatcaatcagcttttgaagatcggcgccgtgccgatcatcaat
gaaaacgacaccgtcgccaccagcgagatccgctatggtgacaatgatcgcctcgccgcc
cgcgtcgcgacgatgaccggcgccgatctgctcatccttctctccgacatcgacggcctc
tacaccgcgccgccgcatctcgatccgaacgcgacgttcctggaaacgattgccgaaatc
acccccgagatcgaggcgatggccggcggtgcggcctccgagctttcgcgcggcggcatg
cgcaccaagatcgatgccggcaagattgcgacggcatcaggctgcgccatgatcatcgcc
tccggcaagaccgacaatcctctgtcggcaatcgaaaacggcgcgcgttcctcgtggttc
gcgccgtcgggcacacccgttaccgcccgcaagacctggattgccggccagttgcagccg
gccggcgaactgcatgtcgatgacggcgccgtcacagccctcggcgccggcaagagcctg
cttcccgccggcgtgcgcagcgtttccggcctcttcagccgcggcgatacggtggcggtc
atcggcccggccggccgcgagatcgcccgcggccttgttagctacgatgccgacgacgcc
cgtcggattgccggccgcaagtcggcggagatcgaggccatcctcggttatgccgggcgc
gccgccatggtccatcgcgacgacatggtgatgaccgcgcagatcggttcgaaatcggaa
aggcagaagaaggacgcgagctatgcttga

DBGET integrated database retrieval system