KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4282Help
Entry
Rleg_4282         CDS       T00926                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00260  Glycine, serine and threonine metabolism
rlg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rlg01100  Metabolic pathways
rlg01110  Biosynthesis of secondary metabolites
rlg01130  Biosynthesis of antibiotics
rlg01230  Biosynthesis of amino acids
Module
rlg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rleg_4282
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rleg_4282
Enzymes [BR:rlg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rleg_4282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ACS58522
UniProt: C6B118
Position
4384509..4385348
Genome map
AA seq 279 aa AA seqDB search
MTARMDKRFAELKAEGRPALVTYFMGGDPDYDTSLGIMKALPEAGSDIIELGMPFSDPMA
DGPAIQLAGQRALKGGQTLKKTLQLAADFRKTNDATPIVMMGYYNPIYIYGVEKFLDDAL
AAGIDGLIVVDLPPEMDDELCIPAIRKGINFIRLATPTTDEKRLPKVLKNTSGFVYYVSM
NGITGSALPDPSLVSGAVERIKQHTSLPVCVGFGVKTAEHAKVIGGSADGVVVGTAIVNQ
VATSLTHDGKATADTVQAVATLVRGLSTGTRSARLVAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatggacaaacgctttgccgagctgaaggccgagggccgtccggcgctt
gtgacctatttcatgggcggcgatcctgactacgacacctcgcttggcatcatgaaggcg
ctgccggaggcgggctcagacattatcgagctcggcatgcccttttccgatccgatggcc
gacggcccggcgatccagctggccggccagcgcgcgctgaaaggcggccagacgctgaag
aagacgctgcagctggcggccgatttccgcaagaccaacgatgcgacgccgatcgtgatg
atgggttactacaacccgatctatatttacggcgtcgagaaattcctcgacgacgcactc
gccgccggcatcgacggcctgatcgtcgtcgacctgccgcccgagatggatgacgaactc
tgcattccggcgatccgcaagggcattaatttcattcgcctggcgacgccgacgaccgat
gagaagcgcctgccgaaggtattgaagaacacctccggcttcgtctactacgtctcgatg
aacggcatcaccggttcggcgctgcccgatccgtcgctggtttcgggcgcggtcgagcgc
atcaagcagcataccagcctgcccgtctgcgtcggcttcggcgtcaagacggcggaacat
gcaaaggtcatcggcggttcggccgacggcgtcgtcgtcggcaccgcgatcgtcaatcag
gtcgcgaccagcttgacgcatgacggaaaggcaacggcggacaccgttcaggccgttgcc
acgctggtgcgtggcctttccacgggaacacgttcggcgcgccttgttgctgccgaatag

DBGET integrated database retrieval system