KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4736Help
Entry
Rleg_4736         CDS       T00926                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00071  Fatty acid degradation
rlg00072  Synthesis and degradation of ketone bodies
rlg00280  Valine, leucine and isoleucine degradation
rlg00310  Lysine degradation
rlg00362  Benzoate degradation
rlg00380  Tryptophan metabolism
rlg00620  Pyruvate metabolism
rlg00630  Glyoxylate and dicarboxylate metabolism
rlg00640  Propanoate metabolism
rlg00650  Butanoate metabolism
rlg00900  Terpenoid backbone biosynthesis
rlg01100  Metabolic pathways
rlg01110  Biosynthesis of secondary metabolites
rlg01120  Microbial metabolism in diverse environments
rlg01130  Biosynthesis of antibiotics
rlg01200  Carbon metabolism
rlg01212  Fatty acid metabolism
rlg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rlg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rleg_4736
   00630 Glyoxylate and dicarboxylate metabolism
    Rleg_4736
   00640 Propanoate metabolism
    Rleg_4736
   00650 Butanoate metabolism
    Rleg_4736
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rleg_4736
   00072 Synthesis and degradation of ketone bodies
    Rleg_4736
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rleg_4736
   00310 Lysine degradation
    Rleg_4736
   00380 Tryptophan metabolism
    Rleg_4736
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rleg_4736
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rleg_4736
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rleg_4736
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rlg04147]
    Rleg_4736
Enzymes [BR:rlg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rleg_4736
Exosome [BR:rlg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rleg_4736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACS58966
UniProt: C6B4F8
Position
pR132501:103853..105058
Genome map
AA seq 401 aa AA seqDB search
MSYAFQPDEDWQPVVVAAYRSPIGRAFGSLATVAAEDLLAPIMHRILLETGIAPDTIDDV
LVGNAAGGGGNIARLAALTAGLPMSVPGVAIDRQCGSGLEAIIMAARLIQAKAGACFLAG
GVESVSTAPWRVERPKANGMPPRFYGRARFSPETIGDPEMGIAAENVARQFGISRQRQDE
FALRSHRLAVAAAEAGIFRPEIVEISTGHGPIERDECPRASTSLEALANLRPVFLADGSV
TAGNACPLNDGACLVLVMSRGMARSMGVEKGLAFIDSAAAGVDPNLLGIGPVASTRKLLK
RQPELSLLDIDAIEFNEAFAAQVLASLDQLAIPADAINKDGGAIALGHPFGASGAILVTR
LYSQLIRNTGEVGAPGATALAMIGIGGGIGLTAMFEATQLS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttgtcctacgcctttcagcctgacgaggattggcagccagtcgtggttgccgcctaccgg
tcgccgatcggtagggctttcggatcgcttgcgactgtcgcggcggaagacttgcttgcg
ccgatcatgcatcggatccttttggaaacgggaattgcacccgacacgatagacgacgtt
ctggtgggcaatgccgccggcggcggtggaaacatcgcgcggctggcagcgctcacagca
ggtctgcccatgtcggttccgggtgttgcgatcgaccggcaatgcggctcgggcctggaa
gcgatcatcatggcggcccgcttgatccaggcgaaagccggcgcgtgttttctcgctggc
ggcgtcgagagcgtcagcaccgcgccatggcgcgtcgaaagaccaaaggcgaacgggatg
ccgccgcgattttacgggcgcgcccggttttcgcctgaaacgatcggcgatccggaaatg
ggaattgccgccgagaacgtcgcgcgtcagttcggcatatcgcgccagagacaggatgaa
tttgccctgcgcagccataggctcgccgtagcggcggccgaggcaggcatctttcgcccc
gagatcgtcgagatttccaccggccacgggccgatcgaacgggacgaatgcccacgcgcc
tccacctctcttgaggcgctcgcaaacctccggccggtcttcctggccgatggatcggtc
acagcaggcaatgcctgcccgctgaacgacggcgcctgcctggtgctggtcatgagccgc
gggatggcaaggagtatgggcgtcgaaaagggcctcgccttcatcgacagcgctgctgcc
ggtgtggatccgaatctgctcggcatcgggccggtcgcttcgaccaggaagctattgaag
cgtcagcccgagctctcactcttagacatcgatgccatcgaattcaacgaggctttcgcg
gcccaggttctggcatcgctggaccagctcgctatccctgccgacgcgatcaacaaggac
ggcggagccattgcgctcggccatccgttcggggcgtccggcgcaatcctcgttaccagg
ctgtacagccagctgatccgcaacaccggggaagtcggggcgcccggcgcaactgccttg
gccatgatcggaatcggcggaggcatcgggctgaccgccatgttcgaggctactcagctt
tcctga

DBGET integrated database retrieval system