KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_5485
Entry
Rleg_5485         CDS       T00926                                 
Name
(GenBank) type IV secretion/conjugal transfer ATPase, VirB4 family
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rlg00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rleg_5485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rlg02044]
    Rleg_5485
Enzymes [BR:rlg01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Rleg_5485
Secretion system [BR:rlg02044]
 Type IV secretion system
  Trb secretion system protein
   Rleg_5485
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_22 AAA_10 DUF87 AAA_29 ABC_tran AAA_23 AAA_16 AAA_21 ATPase_2 Zeta_toxin FtsK_SpoIIIE T2SSE AAA_7
Other DBs
NCBI-ProteinID: ACS60302
UniProt: C6B8R4
Position
pR132503:70069..72516
AA seq 815 aa
MVSLRAFRHTAPSFADLVPYAGLVDNGIILLKDGSLMAGWYFAGPDSESSTDFERNEVSR
QINAILSRLGSGWMIQVEAVRLATVDYASAGKSHFPDRVTQAIDEERRAHFEREQGHFES
RHAIIATYRPTEQRRSRLSKYIYSDEDSRKQSYADTVLFIFRNAIREVEQYLANIISIRR
MLTRETAERGGACVARYDELLQFVRFCVTGENHPVRLPDIPMYIDWIVTAELQHGLAPKV
EDRFLGVVAIDGLPSESWPGILNSLDAMPLGYRWSSRFIFLDAEEARVRLERTRKKWLQK
VRPFFDQLFQTQSRSVDQDAISMVAETEDAIAQASSQLVAYGYYTPVVVLFDNDAERLNE
KTEAIRRLIQAEGFGARIETLNATDAYLGSLPGNWYCNIREPLINTRNLSDLIPLNSVWS
GNPQAPCPFYPPDSPPLMQVATGSTPFRLNLHVDDVGHTLVFGPTGSGKSTLLALIAAQF
RRYENAQIFAFDKGRSMLPLTLACGGDHYEIGGDEDTGLSFCPLSELSSDGDRAWASEWI
ESLVAMQGISITPDHRNAISRQIGLMDGAPGRSISDFVSGVQMREIKDALHHYTVDGPMG
QLLDAETDGLALGLFQTFEIEQVMNMGERNLVPVLTYLFRRIEKRLTGAPSLIVLDEAWL
MLGHPVFRDKIREWLKVMRKANCAVLLATQSISDAERSGIIDVLKESCPTKICLPNGAAR
ETGTRDFYERIGFNRRQIEIVATAIPKREYYVASPEGRRLFDMALGPLTLSFVGASSKDD
LKHIRALHEEHGPEWPLHWLHKRGIKDAASLLKDA
NT seq 2448 nt   +upstreamnt  +downstreamnt
atggtatcccttcgcgctttccggcacacggcgccgtccttcgccgatctcgtcccctac
gcagggcttgtcgataacgggatcatcctgctcaaggatggctcactgatggctggctgg
tattttgccgggcctgattccgaaagctccaccgatttcgaacggaacgaggtgtcgcgc
cagatcaacgccatattgtcacgtctcgggtccggttggatgatccaggtagaggcggtg
cggctcgcaacggtcgactacgcctcggctgggaaatcgcatttccccgatcgggtgacg
caggcgatcgacgaggaacgacgagcccacttcgagcgcgagcaggggcatttcgaaagc
cgtcatgccatcatcgccacctatcggccgaccgagcagcgtcgatcgaggctcagcaag
tacatctattccgacgaagacagtcgaaagcaatcctatgccgacaccgtgctcttcatc
ttccgcaatgcgatccgggaagtcgaacagtatctcgccaatatcatttccatcaggcga
atgctgacccgggagaccgccgagcgcggcggcgcgtgcgttgctcgctatgacgaactg
ctacaattcgtccgcttttgcgtgacgggcgagaaccaccctgtccgacttcccgatatc
ccaatgtatatcgactggatcgtgaccgccgagcttcagcacggtcttgctcccaaggtg
gaggaccgttttctcggcgtggtggcaatcgacggccttccatccgaaagctggccgggc
atcctgaacagcctggatgcgatgccgcttggctatcgatggtcgtcgcgcttcattttc
ctcgacgccgaggaggcgagggtacgccttgagcggacccgcaagaagtggctgcagaag
gttcgacctttcttcgaccaacttttccagacgcaaagccgttcggtcgaccaggacgca
atatcgatggtcgccgagaccgaggatgcaatcgcacaagcatcgtcacagctcgtcgct
tatggatattacacgccggtcgtcgtgctgttcgacaacgatgcggaacgacttaacgaa
aagacggaagcgatccggcgtctcatccaggccgagggctttggcgcacgaatcgagacg
ctgaatgcgaccgacgcctatttggggagcctgcctggaaactggtattgcaacattcgc
gagccgctgatcaacacgcgcaatctctccgatctcatcccgctcaactccgtctggtcc
ggaaatccgcaggcaccttgcccgttttacccacccgattcaccaccgctgatgcaggtc
gcgaccggctcgacgccctttcggctcaaccttcatgtcgatgacgtcggccataccctg
gtgttcggtcccaccggctcaggaaagtcgacgctccttgcgctgatcgctgcacagttc
cgccgctacgagaacgcccagatcttcgccttcgacaaaggccgttcgatgctgccgctg
acacttgcttgcggcggcgatcactacgagatcggcggcgacgaagacaccgggctctcc
ttttgcccgctgtccgaactgtcgtcggacggcgatcgtgcctgggcgtccgagtggatc
gaaagcttggtggcgatgcagggcatctcgatcacgcccgatcaccgcaacgccatctcc
cgccagatcggcctgatggacggggctccgggtcggtcgatctcggatttcgtcagtggc
gttcagatgcgcgagatcaaggatgctctccatcactacaccgtcgacggcccgatgggc
cagttgctcgatgccgagaccgacggcctcgcactggggctatttcagacgtttgaaatc
gagcaggtcatgaacatgggcgagcgcaatctcgtgccggtgctcacctatctcttccgc
cgcatcgaaaaacgcctaaccggcgcgccaagcctcatcgtcctcgacgaggcctggctg
atgctcggtcatcccgtgttccgcgacaaaatccgggaatggctcaaggtgatgcgcaaa
gccaattgcgcggtgttgcttgccacccagtcgatctcggatgccgaacgctctggcatc
atcgacgtcctgaaagagagctgcccaacgaaaatctgcctgccgaatggggcagcccgc
gagaccgggacccgcgatttctatgagcggatcggctttaaccgacggcagatcgagatc
gtcgcgaccgccataccgaaacgggaatattacgtcgcgtcacccgaagggcgccgcctg
ttcgacatggctcttggcccgctgacgctgtcgttcgtgggcgcctcgagtaaggacgac
ttgaagcacatccgtgcgcttcatgaagaacatggccctgaatggccgctgcactggctc
cacaaaagagggatcaaggatgctgcatcgcttctcaaagacgcatag

DBGET integrated database retrieval system