KEGG   Roseobacter litoralis: RLO149_c000620Help
Entry
RLO149_c000620    CDS       T01572                                 

Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rli  Roseobacter litoralis
Pathway
rli00480  Glutathione metabolism
rli00590  Arachidonic acid metabolism
rli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rli00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    RLO149_c000620
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RLO149_c000620
Enzymes [BR:rli01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RLO149_c000620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA DUF4174
Motif
Other DBs
NCBI-ProteinID: AEI92094
UniProt: F7ZDX5
Position
67123..67671
Genome map
AA seq 182 aa AA seqDB search
MRTSKRALAAVVSAVFAAGSVWAGARDHQFASIDGGYLEMADWAGQPVLVVNTASQCGFT
GQYAGLQKLYDTYRDAGLVVFAIPSDDFNQELGSAQEVKEFCEMNYGLDMPMADITRIRG
KNAHPFYQEVRAETGFVPRWNFNKVLIGLDGEVVETWGSQTKPMSREITETVEGLLEKAG
RG
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaggacttcgaaaagagcattggcggcagtcgtatccgccgtatttgccgcaggctcg
gtttgggccggcgcacgtgatcaccagtttgcatccatcgacggcggttatctggaaatg
gccgattgggcgggacagcccgtgctggtcgtcaataccgcatcgcaatgtgggtttacg
ggccaatacgccgggctgcagaagctctacgacacctaccgcgacgcgggtcttgtggtt
ttcgcgattccatcagatgatttcaaccaagagcttggtagtgcacaggaggtcaaggag
ttctgcgagatgaactatggactggacatgccgatggcggacatcacgcgcatccggggt
aagaacgcacatccgttttatcaggaagtacgcgcggaaaccgggtttgtgccgcgctgg
aacttcaataaggttttgatcgggctggacggggaagtcgtggaaacctggggttcgcag
accaaaccgatgtcacgtgaaataaccgagacggttgaggggcttctggaaaaagcaggt
cgggggtga

DBGET integrated database retrieval system